SecReT6
Protein ID: 377807594
SecReT6 ID516
T6SS typei1
Gene symbol-
Locus tagBYI23_C002020
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]227190..227879 [+]
Producthypothetical protein
NoteTssL
UniProt IDG8MJE5
KEGG IDbyi:BYI23_C002020
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.90E-35, Aligned region: 2..214
Protein Sequence: 229 a.a.     [Download]
>gi|377807594|ref|YP_004978786.1| hypothetical protein BYI23_C002020 [Burkholderia sp. YI23]
MTLADTLIPLFAHVRAFTRSPSGDAASLTAQLDSAIAAARLRAHDAGFAQADIDEALFAFNAWADELLLT
TQWEGAPQWQRHLLQRRYSNVSNAGVVFYERLAQLTPSQLAVREVFYLCLALGFGGRYAYDRNQKTLTDI
RRTNLAMLLPDADQLGASARAFLFPDGYHTAGDEAAARGQSARARFSARFTRGKLTAIVLPLLLLALLYG
VYHTVVAQSVESLLAQIHL
 
Nucleotide Sequence: 690 bp     [Download]
>gi|377807392|ref|NC_016590.1|:227190-227879 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGACCCTCGCCGATACGCTCATTCCCCTGTTCGCGCACGTGCGCGCCTTCACGCGCTCGCCTTCGGGCG
ATGCCGCGAGCCTCACCGCGCAGCTCGACAGCGCCATCGCGGCGGCGCGGCTGCGCGCGCACGACGCCGG
TTTCGCGCAGGCCGATATCGACGAGGCGCTGTTCGCCTTCAACGCCTGGGCCGACGAACTGCTGCTCACG
ACGCAATGGGAAGGTGCGCCGCAATGGCAGCGTCATCTGTTGCAGCGGCGCTATTCGAACGTGAGCAACG
CGGGCGTCGTGTTCTACGAGCGCCTCGCGCAACTGACGCCTTCGCAACTGGCGGTGCGCGAAGTGTTCTA
TCTGTGTCTCGCGCTCGGCTTCGGCGGGCGCTATGCGTACGACCGCAACCAGAAGACGCTCACCGACATC
CGCCGCACCAATCTCGCGATGCTACTGCCCGACGCTGACCAGCTCGGCGCGTCGGCGCGCGCGTTCCTGT
TTCCGGACGGCTATCACACCGCGGGCGATGAAGCCGCGGCGCGCGGCCAAAGCGCGCGCGCCCGTTTTTC
GGCGCGCTTCACGCGCGGCAAGCTGACCGCGATCGTCTTGCCGCTGCTCCTGCTGGCGCTGCTGTACGGC
GTGTATCACACCGTCGTCGCGCAGTCCGTCGAGTCGCTTCTCGCGCAGATCCATCTATGA
 Primer design