SecReT6
Protein ID: 377807595
SecReT6 ID516
T6SS typei1
Gene symbol-
Locus tagBYI23_C002030
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]227876..231694 [+]
Productlipoprotein
NoteTssM
UniProt IDG8MJE6
KEGG IDbyi:BYI23_C002030
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-50, Aligned region: 175..424
ImcF-related_N [PF14331], Evalue: 1.30E-50, Aligned region: 505..550
ImcF-related_N [PF14331], Evalue: 1.30E-50, Aligned region: 1021..1061
DUF1215 [PF06744], Evalue: 0.00026, Aligned region: 499..516
DUF1215 [PF06744], Evalue: 0.00026, Aligned region: 919..1001
AAA_22 [PF13401], Evalue: 0.0087, Aligned region: 115..157
Protein Sequence: 1272 a.a.     [Download]
>gi|377807595|ref|YP_004978787.1| lipoprotein [Burkholderia sp. YI23]
MKTLGIALLWLLTLIVVGLISWGVVLYFGWPLWVALAIFVGVFALYFFVAFARRMIVMMRSRSRLAAQSA
ALHVEAPAASPETVLKRKWKAAVATLRQSNLRSQGDPLYALPWFMVIGQSGTGKTTALTRARLSSPIQKI
SQQANIGQTANCDWWYFDRAVVIDCAGRYVQAEDIEQDRREWETGLDLLGRYRPREGLDGLVLAVSADRL
MTPDADTFADEGRIVRARIEQLIRMFGKRFPVYVLVTKCDRLYGFEEWAKTLPADALGQAMGYLAEESET
GEGAFVSRAFDSIGARLQALRLALVSRDAQPSPELLMFPNELDQLRGGLSMFLATCLADSPYLERPLLRG
IFFSSGQQEGGAMSSLMSTLLPPTPAHASDTAGVFLHDFFGRILPQDRNAAKPAMLAHHWRRVTQSVGVV
AWVLLLAMFGILLSVSFAGNRQTLALVQSARPDRIALNGNLFHDAAALSYSNDVLMQVAQNDRRWMSGLL
GNGAGLETLEARLHDVFLQQYRQAIQPAADQSQQMALAAQDGQAGQILNLARSIALLRARIGGADRATLD
AMPQPLATSLYPAQLNDQLNPLAVSYLAWSPRDAGYLQERLKNQRALLDQAVAADPQMTWLVGLVPDGGS
VPPVRAADFWGGSAPSANTGMQTSNGSVTGASTVNAGNATVPAVYTVAGRKALDDLAKQIRAAASDPSRF
DRQRAAFDDWYRGQRVIAWQNFVEAFTHNAAPYSGEAGWRSALGIVSGPASPYFRLIARIDEEFGGERAD
APLPGWIALARQFQQVREQATRMGAANQAVRMAGAINAVGATAIKDVLAGAPQRGSQAVTNNLGAVDAFS
LYVAGLNKLAIDSGAGSGKNYQLASDFAQFATNPQPQPSEMMSALQPLTQLRTLIGTGDGSDALTWRLIR
GPFDFLAAYIEQQASCDLQRGWESAVVFPLQGATDKSAAIDQLFGAKGAVWAFADGAAKPFLTRNASRYD
IVETQGFSVPFTPAFVPMLNGAYGRQLAQQRTAARSAADKEAQQLQAQKAQLDAQQSLDQLDRTLTTAKQ
QADAARALTVPLTLTAQPTNVNAGAQAKPYATILTVQCAAGVQTLNNYNFPVSTSFAWAAGQCGETRLSI
KIGNLTLNRSYAGPLGVAAFLQDFADGQRQFTPADFPASESALKALDVSALTVSFSVTGGDQVIDAARKI
ESYESLQKTTAQQKQQIQDAQAQRQQMNIVDQLAVMTPGMPPLPAIIPTVAGNPVSLAELGLPATIGACW
RGQTSPMMMTGL
 
Nucleotide Sequence: 3819 bp     [Download]
>gi|377807392|ref|NC_016590.1|:227876-231694 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGAAAACGCTGGGCATCGCATTGCTGTGGCTGCTGACGCTGATCGTCGTGGGACTGATCAGCTGGGGCG
TCGTTCTCTATTTCGGCTGGCCGCTGTGGGTCGCGCTCGCGATTTTCGTCGGCGTGTTCGCGCTGTACTT
TTTCGTCGCCTTCGCGCGGCGCATGATCGTGATGATGCGCTCGCGCAGCCGCCTCGCGGCCCAGAGCGCG
GCGCTCCATGTCGAGGCGCCGGCCGCGTCGCCGGAAACGGTTCTGAAGCGCAAGTGGAAAGCCGCCGTGG
CCACGCTGCGGCAGTCGAATCTGCGCAGCCAGGGCGATCCGCTCTACGCGCTGCCGTGGTTCATGGTGAT
CGGGCAATCGGGCACGGGCAAGACGACGGCGCTCACGCGCGCGCGGCTGTCCTCGCCGATCCAGAAGATC
AGCCAGCAGGCGAACATCGGGCAGACGGCCAATTGCGACTGGTGGTATTTCGATCGCGCTGTCGTGATCG
ATTGCGCGGGCCGCTACGTGCAGGCGGAAGACATCGAGCAGGACCGGCGCGAATGGGAAACCGGCCTCGA
CCTGCTCGGACGCTACCGGCCGCGCGAAGGGCTGGACGGCCTCGTGCTCGCCGTGAGCGCCGACCGGCTC
ATGACGCCCGACGCCGATACCTTCGCCGACGAAGGGCGCATCGTGCGCGCGCGCATCGAACAGTTGATAC
GCATGTTCGGCAAGCGCTTTCCGGTGTACGTGCTCGTCACCAAGTGCGACCGTCTCTACGGCTTCGAGGA
ATGGGCGAAGACGCTGCCCGCCGATGCGCTCGGCCAGGCGATGGGCTATCTCGCCGAAGAGAGCGAGACG
GGCGAGGGCGCATTCGTTTCGCGCGCCTTCGATTCGATCGGCGCGCGCTTGCAGGCGCTGCGGCTCGCGC
TGGTTTCGCGCGACGCGCAGCCATCGCCCGAACTGCTGATGTTCCCGAACGAGCTGGACCAGTTGCGCGG
CGGCCTGTCGATGTTCCTCGCCACCTGTCTCGCCGACAGCCCGTATCTCGAACGGCCGCTGTTGCGCGGC
ATCTTCTTTAGCAGCGGACAGCAGGAAGGCGGCGCGATGTCTTCCCTGATGAGCACGCTCCTGCCGCCGA
CGCCCGCGCATGCGAGCGACACGGCGGGCGTCTTCCTGCACGATTTCTTCGGCCGCATCCTGCCGCAGGA
TCGCAACGCCGCGAAGCCGGCCATGCTCGCGCATCACTGGCGGCGCGTCACGCAAAGCGTCGGCGTGGTC
GCCTGGGTGCTGCTGCTCGCCATGTTCGGCATCCTGCTTTCCGTGTCGTTCGCGGGCAACCGGCAGACGC
TCGCGCTCGTGCAGAGCGCGCGCCCCGACAGGATCGCGCTGAACGGCAACCTGTTTCACGACGCCGCCGC
GCTCTCGTATTCCAACGACGTGCTGATGCAGGTCGCGCAGAACGACCGGCGCTGGATGTCGGGCCTGCTC
GGCAACGGCGCGGGCCTCGAGACGCTCGAAGCGCGTCTGCACGACGTCTTCCTGCAGCAATACCGGCAGG
CGATTCAGCCCGCCGCGGATCAAAGCCAGCAGATGGCGCTCGCCGCGCAGGACGGGCAGGCGGGGCAAAT
CCTGAATCTGGCGCGCTCGATCGCCTTGCTGCGCGCGCGCATCGGCGGGGCGGACCGCGCGACGCTCGAC
GCCATGCCGCAGCCGCTCGCGACCTCGCTCTATCCCGCGCAATTGAACGACCAGCTCAATCCGCTCGCGG
TCTCGTATCTCGCATGGTCGCCGCGCGACGCGGGCTATCTGCAGGAGCGTCTGAAGAACCAGCGCGCGCT
GCTCGATCAGGCCGTCGCCGCCGATCCGCAGATGACCTGGCTCGTCGGACTCGTGCCGGACGGCGGCAGT
GTTCCGCCCGTGCGCGCCGCCGATTTCTGGGGCGGCAGCGCACCCTCCGCGAATACGGGCATGCAGACGT
CGAACGGCAGCGTGACGGGCGCAAGCACCGTCAACGCGGGCAACGCGACCGTGCCGGCCGTGTACACCGT
CGCGGGCCGCAAGGCGCTCGACGATCTGGCGAAGCAGATTCGCGCCGCGGCGAGCGACCCGTCCCGCTTC
GACAGGCAGCGCGCCGCGTTCGACGACTGGTATCGCGGCCAGCGCGTGATCGCATGGCAGAACTTCGTCG
AGGCCTTCACGCACAACGCCGCGCCGTATTCGGGCGAAGCGGGCTGGCGCTCGGCGCTCGGCATCGTCAG
CGGGCCGGCCAGTCCGTATTTCCGCCTGATTGCGCGCATCGACGAGGAATTCGGCGGCGAGCGCGCCGAC
GCGCCGCTGCCCGGCTGGATCGCGCTCGCGCGGCAATTCCAGCAGGTGCGCGAGCAGGCGACGCGCATGG
GCGCGGCAAATCAGGCCGTGCGCATGGCGGGCGCGATCAACGCGGTCGGGGCCACGGCGATCAAGGACGT
GCTCGCGGGCGCGCCGCAGCGCGGCAGCCAGGCGGTCACGAACAATCTCGGCGCCGTCGATGCGTTCTCG
CTCTATGTCGCCGGTCTGAACAAGCTCGCCATCGACAGCGGAGCGGGCAGCGGCAAGAACTATCAACTGG
CGTCGGATTTCGCGCAGTTCGCGACGAACCCGCAGCCGCAGCCGTCCGAGATGATGAGCGCGCTGCAACC
GCTCACGCAGTTGCGCACGCTGATCGGCACCGGCGACGGTTCGGACGCGCTCACGTGGCGTCTCATCCGC
GGCCCGTTCGATTTCCTCGCGGCGTATATCGAGCAGCAGGCGTCGTGCGACTTGCAGCGCGGCTGGGAAT
CGGCCGTGGTGTTTCCGCTGCAGGGCGCGACCGACAAGAGCGCGGCCATCGATCAGCTGTTCGGCGCGAA
GGGCGCGGTGTGGGCCTTTGCGGACGGCGCGGCCAAGCCGTTCCTCACGCGCAATGCGAGCCGCTACGAC
ATCGTCGAGACGCAGGGTTTCAGCGTGCCGTTCACGCCGGCTTTCGTGCCGATGCTCAACGGCGCATACG
GACGCCAGCTCGCCCAGCAACGAACGGCCGCACGCAGCGCCGCCGACAAAGAGGCGCAGCAGCTTCAGGC
GCAGAAGGCGCAACTCGACGCGCAACAGTCGCTCGATCAGCTCGACCGCACGCTTACGACGGCCAAGCAA
CAGGCCGATGCGGCCCGCGCGCTGACCGTGCCGCTCACGCTCACCGCGCAGCCGACCAACGTCAACGCCG
GTGCACAGGCGAAGCCCTACGCGACCATTCTCACCGTGCAGTGCGCGGCGGGCGTGCAGACGCTCAACAA
CTACAACTTCCCGGTCAGCACGAGCTTCGCGTGGGCGGCGGGACAGTGCGGCGAAACGCGTCTTTCGATC
AAGATCGGCAATCTGACCTTGAACCGCAGCTATGCGGGGCCGCTCGGCGTCGCGGCGTTCCTGCAGGATT
TCGCGGATGGCCAGCGCCAGTTCACGCCCGCGGATTTCCCGGCGAGCGAGTCGGCGCTGAAGGCGCTCGA
CGTGAGCGCGCTGACCGTGAGCTTCTCGGTGACGGGCGGCGATCAGGTCATCGATGCCGCGCGCAAGATC
GAGTCCTACGAATCGCTGCAAAAGACCACGGCGCAACAGAAGCAGCAGATTCAGGACGCGCAGGCGCAGC
GCCAGCAGATGAACATCGTCGATCAGCTTGCCGTGATGACCCCGGGCATGCCGCCGCTGCCGGCGATCAT
CCCGACGGTGGCGGGCAATCCGGTGAGCCTCGCCGAACTGGGCTTGCCGGCGACCATCGGCGCATGCTGG
CGCGGCCAGACATCGCCGATGATGATGACCGGGCTTTGA
 Primer design