SecReT6
Protein ID: 377807596
SecReT6 ID516
T6SS typei1
Gene symbolimpA
Locus tagBYI23_C002040
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]231695..233278 [-]
Productprotein ImpA
NoteTssA
UniProt IDG8MJE7
KEGG IDbyi:BYI23_C002040
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.80E-19, Aligned region: 48..107
Protein Sequence: 527 a.a.     [Download]
>gi|377807596|ref|YP_004978788.1| protein ImpA [Burkholderia sp. YI23]
MNDFKSLGARPISDAQPCGADVRDDPDFELLQDEIAKLTNPAASGSPDWAQVVRLSTALTAGKGKDLLVA
SYLAGGLLMTRGLAGLNDGAQLLEGLLATHWDGLYPPVSRLRARRNAVQWLIDRVRAHGDEHDWSSWPPQ
DAALVDGLRAALAGIDSVLAEKDGDAPSMQPLRALLGTVQVAEPEPEPVPEPVPEPVAEPTPQPVAAATP
APAPMAKPVPAPVPSAAPPTEAVDSADTASRATDEALDRLAAIGNWYAQNEPSSAIGFRLRRMGVWAGIE
RAPVANGADTQLPGPIPQLADALRNLQSRAAHADIVGFAEAQVLTYPFWLDLNHAAATSLAQLGDAWSAA
HREVRNETAKFVSRMEGIERLKFANGVPFANADTMQWLGTLASPGGDAAAVAPDPLATVLSRARALAADN
DLRAAAQCLQDAIDKTAAVATRLRLRTALCDLLLENRPGARLDAFARALVEEIDRYGVSAWDPELTADAL
RAAYAILSRNDQNEAETAALLARIAPLDVAIAVRLIT
 
Nucleotide Sequence: 1584 bp     [Download]
>gi|377807392|ref|NC_016590.1|:c233278-231695 Burkholderia sp. YI23 chromosome 3, complete sequence
GTGAACGATTTCAAGAGCCTTGGTGCACGACCCATCAGCGATGCGCAGCCCTGCGGCGCGGACGTGCGCG
ACGATCCCGATTTCGAACTGCTGCAAGACGAAATCGCGAAACTGACCAATCCGGCCGCGAGCGGCTCGCC
GGACTGGGCGCAAGTAGTGCGGCTCTCGACGGCGCTGACCGCCGGCAAGGGCAAGGACCTGCTCGTCGCG
AGCTATCTGGCGGGCGGCCTGCTGATGACGCGCGGGCTCGCCGGCCTGAACGACGGCGCGCAACTGCTCG
AAGGACTGCTCGCGACGCACTGGGACGGGCTTTATCCGCCGGTCTCGCGGCTGCGCGCGCGGCGCAATGC
GGTGCAATGGCTGATCGATCGCGTGCGCGCGCATGGCGACGAGCACGACTGGTCGAGCTGGCCGCCGCAG
GACGCGGCGCTCGTCGATGGCTTGCGCGCGGCGCTCGCGGGCATCGACAGCGTGCTCGCGGAAAAGGACG
GCGACGCGCCTTCCATGCAGCCATTGCGCGCGCTGCTCGGGACCGTGCAGGTGGCGGAGCCCGAGCCTGA
GCCCGTTCCTGAGCCTGTGCCCGAGCCGGTTGCGGAGCCAACGCCGCAGCCCGTGGCGGCGGCAACGCCC
GCGCCCGCTCCCATGGCGAAACCGGTGCCGGCGCCCGTGCCCTCGGCCGCGCCGCCAACCGAAGCCGTCG
ATTCCGCCGATACCGCCAGCCGCGCCACCGACGAAGCGCTCGACCGGCTCGCCGCCATCGGCAACTGGTA
CGCGCAGAACGAACCGTCGAGCGCCATCGGCTTCCGGCTGCGGCGCATGGGCGTGTGGGCGGGCATCGAG
CGCGCGCCGGTCGCGAACGGCGCGGACACGCAGCTTCCCGGCCCGATTCCGCAACTGGCGGACGCCTTGC
GCAACCTGCAATCGCGCGCGGCGCACGCGGACATCGTCGGCTTCGCGGAAGCGCAAGTGCTGACGTATCC
GTTCTGGCTCGATCTGAATCACGCCGCCGCGACGTCGCTCGCGCAACTCGGCGACGCGTGGAGCGCCGCG
CATCGCGAAGTCCGCAACGAGACCGCGAAGTTCGTGTCGCGCATGGAAGGCATCGAGCGGCTGAAGTTCG
CCAACGGCGTGCCGTTCGCCAATGCCGATACCATGCAATGGCTCGGCACGCTCGCCTCGCCGGGCGGCGA
TGCGGCCGCCGTTGCGCCCGATCCGCTCGCCACGGTGCTGTCGCGGGCGCGCGCGCTTGCCGCGGACAAC
GACTTGCGCGCCGCCGCGCAATGCCTGCAGGACGCCATCGACAAAACGGCGGCCGTGGCCACGCGTCTGC
GTCTGCGCACGGCGCTGTGCGATTTGCTGCTGGAGAATCGTCCGGGCGCGCGGCTCGATGCGTTCGCACG
CGCGCTGGTGGAGGAAATCGACCGCTACGGCGTGAGCGCGTGGGACCCGGAACTGACGGCCGACGCGTTG
CGCGCCGCCTACGCCATTCTGAGCCGCAACGACCAGAACGAAGCCGAAACGGCCGCGCTGCTGGCGAGAA
TCGCACCGCTGGACGTGGCCATCGCGGTGCGCCTGATTACCTGA
 Primer design