SecReT6
Protein ID: 377807597
SecReT6 ID516
T6SS typei1
Gene symbol-
Locus tagBYI23_C002050
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]233317..234051 [-]
ProductDNA-binding response regulator
NoteVirG
UniProt IDG8MJE8
KEGG IDbyi:BYI23_C002050
PDB IDNA
Domain hit(s) vs Pfam Response_reg [PF00072], Evalue: 7.40E-25, Aligned region: 9..116
Trans_reg_C [PF00486], Evalue: 3.20E-18, Aligned region: 161..235
Protein Sequence: 244 a.a.     [Download]
>gi|377807597|ref|YP_004978789.1| DNA-binding response regulator [Burkholderia sp. YI23]
MTLQQQHSILVVDDDHSMRVLLIEYLGGHGYKADGAASAQEAIGAFAAKRYDLVLLDLGLPDGDGTELAR
RWREEAQVPIMYITGRKDEADLVMGLELGADDYIIKPFSLREVLARMRAVMRRASATSAAPLTRGKLPNA
YRFAGWTLNLNTRRLSAADQSAVALTNSEFNLLVTFLSSPGRIITREKLLESTRAFDDIYDRAIDVQILR
LRRKIEIDPKKPTLLRTERGAGYIFDTDIEHLWT
 
Nucleotide Sequence: 735 bp     [Download]
>gi|377807392|ref|NC_016590.1|:c234051-233317 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGACTTTGCAGCAGCAACACAGCATCCTCGTCGTCGACGATGACCATTCGATGCGCGTCCTCCTGATCG
AATATCTCGGCGGACACGGCTACAAGGCCGATGGCGCCGCGAGCGCGCAGGAAGCGATCGGCGCGTTCGC
CGCGAAACGCTACGATCTCGTGCTGCTCGACCTCGGCCTGCCCGACGGCGACGGCACCGAGCTCGCCCGC
CGCTGGCGCGAAGAGGCGCAGGTGCCGATCATGTACATCACCGGCCGCAAGGACGAAGCCGATCTCGTCA
TGGGACTCGAACTCGGCGCGGACGATTACATCATCAAGCCGTTTTCGCTGCGCGAAGTGCTCGCGCGCAT
GCGCGCGGTGATGCGCCGCGCGAGCGCGACGTCGGCCGCGCCGCTCACGCGCGGCAAGCTGCCGAACGCG
TATCGCTTCGCGGGCTGGACGCTGAATCTGAACACGCGGCGTCTGTCCGCCGCCGATCAGTCGGCGGTGG
CGCTCACCAATTCGGAGTTCAACCTGCTCGTCACGTTCCTGAGTTCGCCGGGCCGTATCATCACGCGTGA
GAAGCTGCTGGAAAGCACGCGCGCCTTCGACGACATTTACGATCGCGCCATCGACGTGCAGATTCTGCGG
CTGCGCCGCAAGATCGAGATCGATCCGAAGAAGCCGACGCTGTTGCGCACCGAGCGCGGCGCGGGCTATA
TCTTCGACACCGATATCGAACATCTCTGGACCTGA
 Primer design