SecReT6
Protein ID: 377807598
SecReT6 ID516
T6SS typei1
Gene symbol-
Locus tagBYI23_C002060
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]234048..235907 [-]
Productsensor histidine kinase
NoteVirA
UniProt IDG8MJE9
KEGG IDbyi:BYI23_C002060
PDB IDNA
Domain hit(s) vs Pfam HATPase_c [PF02518], Evalue: 6.5e-20, Aligned region: 384..502
MASE1 [PF05231], Evalue: 1.8e-17, Aligned region: 384..502
HisKA [PF00512], Evalue: 1.7e-08, Aligned region: 277..343
Protein Sequence: 619 a.a.     [Download]
>gi|377807598|ref|YP_004978790.1| sensor histidine kinase [Burkholderia sp. YI23]
MESAETLAAIAWPAPAIAIAVLWPMPPRRWPAHLLAVFIAIALTGDFSAASWRSDLGFCLLNVLEVALCA
WLGRRYVDANGTIVTTASLMRFLLLLPLAAIGATSMLGATLASDLSHDGWWREWSTLFVGNGVAVLVLVP
AVLAWRSRLADSAQAPRRAEPLIALACSVAVAALLAAAAALHVSEQVQRAVVSLLLAAIAIHGGLAAAAT
TVGTAAVFGVGLTLMRLGPYRYENAESAWHLQIDMAGLAILTFFVAVAVRERRQLALRLERARRMESLGL
LAGGVAHDFKNILAAVDGYAEIAHDRLAGDSAARTPLREVRAASARGYELTEEILLAARRGDRVRETLDL
MSIVRESVALARPLARNGVVIELEAAQARLCVAAHGGQLVRAVLNLASNAGLAARSRVVLRIGSAPSMDT
PLAIGDAPPGEIAWVDVEDDGPGIPAEHLQHLFEPFFSVRAKGGGSGLGLAIVAGVACEHRGGIAIATGP
QGTRFRLVLPLVSKSAAPADDAPEPARPFGDGERVVLIDDDAQSREDGEDWLAAMGFEPLGYADANEALD
DALRADDDIAFVVADAASLPMNEAAFTARVREQAPRARVAVLSRPFDREALARALKDLP
 
Nucleotide Sequence: 1860 bp     [Download]
>gi|377807392|ref|NC_016590.1|:c235907-234048 Burkholderia sp. YI23 chromosome 3, complete sequence
CTGGAAAGCGCCGAAACGCTCGCGGCGATCGCATGGCCCGCGCCGGCCATCGCCATCGCGGTGCTCTGGC
CGATGCCGCCGCGGCGCTGGCCCGCTCATCTGCTCGCGGTGTTCATCGCGATTGCGCTGACGGGCGATTT
CAGCGCCGCCTCGTGGCGCAGCGATCTCGGCTTCTGCCTCCTCAACGTGCTCGAAGTGGCGCTCTGCGCG
TGGCTCGGCCGGCGCTATGTCGATGCGAACGGGACCATCGTCACGACGGCGAGCCTGATGCGCTTTCTGT
TGCTGCTGCCGCTCGCCGCGATCGGCGCGACGTCGATGCTCGGCGCGACGCTCGCCAGCGACCTGAGCCA
CGACGGCTGGTGGCGCGAATGGAGCACGCTGTTCGTCGGCAACGGCGTCGCGGTGCTGGTGCTCGTGCCG
GCCGTGCTGGCCTGGCGTTCGCGGCTCGCGGACAGCGCCCAGGCGCCGCGCCGCGCCGAGCCGCTGATCG
CGCTCGCGTGCAGCGTCGCGGTCGCCGCACTGCTGGCCGCGGCCGCCGCGCTGCATGTGTCGGAACAGGT
GCAGCGCGCGGTCGTCTCGCTGCTGCTGGCCGCCATCGCGATTCATGGCGGCCTGGCCGCCGCGGCGACC
ACGGTCGGCACGGCGGCGGTGTTCGGTGTCGGCCTCACGCTGATGCGGCTCGGACCGTATCGCTATGAAA
ACGCCGAAAGCGCGTGGCATTTGCAGATCGACATGGCCGGGCTCGCGATCCTGACCTTCTTCGTCGCGGT
GGCCGTGCGCGAGCGCAGGCAGCTCGCGCTCAGACTCGAACGGGCGCGCCGGATGGAATCGCTCGGACTG
CTCGCGGGCGGCGTCGCGCACGATTTCAAGAACATTCTCGCCGCCGTCGATGGCTACGCGGAAATCGCGC
ACGACCGGCTCGCCGGCGATTCCGCCGCCCGCACGCCCTTGCGCGAGGTGCGGGCCGCATCGGCGCGCGG
CTACGAACTGACCGAGGAAATTCTGCTGGCCGCGCGGCGCGGCGATCGCGTGCGCGAAACGCTCGACCTG
ATGTCGATCGTGCGCGAGAGCGTGGCGCTCGCGCGGCCGCTTGCCCGCAACGGCGTCGTCATCGAACTGG
AAGCGGCGCAGGCGCGCCTGTGCGTCGCGGCGCACGGCGGCCAGCTCGTGCGCGCCGTGCTGAATCTGGC
GAGCAACGCCGGTCTCGCGGCGCGCTCGCGCGTGGTGCTGCGCATCGGCAGCGCGCCGTCGATGGACACA
CCGCTCGCGATCGGCGACGCGCCGCCGGGCGAGATCGCGTGGGTCGATGTCGAAGACGACGGCCCCGGCA
TTCCCGCCGAACATCTGCAGCATCTTTTCGAGCCGTTCTTTTCCGTGCGCGCGAAAGGCGGCGGCTCGGG
CCTCGGCCTCGCGATCGTCGCGGGCGTGGCGTGCGAGCATCGGGGCGGCATCGCGATCGCGACCGGTCCG
CAGGGCACGCGTTTTCGTCTCGTGCTGCCGCTCGTCTCGAAGTCGGCCGCGCCGGCGGACGATGCACCGG
AGCCCGCGCGCCCGTTCGGCGACGGCGAGCGCGTGGTGCTCATCGACGACGATGCGCAATCGCGTGAAGA
CGGCGAAGACTGGCTCGCCGCGATGGGCTTCGAGCCGCTCGGCTATGCCGATGCCAACGAAGCCCTCGAC
GACGCCTTGCGCGCGGACGACGACATCGCCTTCGTCGTCGCCGACGCCGCCAGCCTGCCGATGAACGAAG
CCGCTTTCACCGCGCGCGTGCGCGAACAGGCGCCCCGCGCGCGCGTCGCCGTGCTGTCCCGACCATTCGA
CCGCGAAGCGCTCGCTCGCGCCCTGAAGGATCTGCCATGA
 Primer design