SecReT6
Protein ID: 377807763
SecReT6 ID517
T6SS typei3
Gene symbol-
Locus tagBYI23_C003710
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]429392..432901 [+]
Producthypothetical protein
NoteTssM
UniProt IDG8MG00
KEGG IDbyi:BYI23_C003710
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.30E-93, Aligned region: 207..470
IcmF-related [PF06761], Evalue: 1.20E-81, Aligned region: 520..827
IcmF-related [PF06761], Evalue: 1.20E-81, Aligned region: 875..930
DUF1215 [PF06744], Evalue: 1.50E-33, Aligned region: 910..1030
DUF1215 [PF06744], Evalue: 1.50E-33, Aligned region: 1141..1164
Protein Sequence: 1169 a.a.     [Download]
>gi|377807763|ref|YP_004978955.1| hypothetical protein BYI23_C003710 [Burkholderia sp. YI23]
MKWIDTLKKPAVVSFAGVLALVALVWFYGPLVAFDGRAPLDSAARRWLAAALIVLCWAGYWGVRYAKARI
AGSKFVQGLVADALDPARREPDPARQAADAELATLRTRFEDALRTLRETRGGAKQGVAGWLRPRREALYD
LPWYMFVGAPGAGKTTALAHSGLRFPLADRLGAQAVGGVGGTRNCDWWFTDDAVLLDTAGRFTTQDSHEE
ADRGAWLGFLALLRKYRPRRPLDGVMAVVSAADLLQQSDEARAAHAVTIRERLSELNRQLGVRLPVYVVV
TKSDMLAGFSEYFDDFGRDEREQVWGVTFPLASDQGEAEAGTPLARFPDEFRLLHRQVQDRVLQRMQQET
DVRRRALIHSFPQQFAGIEQALQRFLDDAFGDSRFSRAALLRGVYFTSGTQSGRPLDRMMSAMAGSLGLR
REVVMADASSGRAYFVKRLLRDVIFAEQGIAGTDPRTERRRTRFQRIAVGLIGVLLAAGLAGLIVTDRQN
RRFVEESRQQIAALAERAKQTSAGDSPLAVLPLLDAARDLPGGDAERASRDRSWWAGFGLDQREKLGLEA
ERVYQRLLRQTLLPIVVERMEDQLRHAQSEDTATLYEALRAYLMLGDPAHFDPDALQVWAMRTWRQGAMK
DASDAERANIERHLRALFSRGQFDSNLPLDQSLIAHARAVLNRVPLAQRLDGRIQQQLAQQRLPEFTVAK
AAGPSGQIVFVRKSGVPLTQGIDGAYTREGFAAFERLREAALANLPKDDWVLGNGQTRAGAQDTDALRTA
LTRLYSDETIRQWDALLADIGVVPFDAPDQGARVANLLGAPNSPLRALIEGIARETRFTPPAAQPGKLDT
LRKRIGVETDAPAAPTLVDAHFQALHDLAGAPLDDYVNALKDAAATLQAEDTARRQSLPLPATGPLDRLK
LMSQNAPAPLAAILQGVAGNADTVQIQSQRAQLQSAWAASVAPACRQALDGRYPLVRGAARDAAPDDFAR
VLAPGGLVDTFFQQNLQSRIDTSGAVWKWRPEAKALGLSDDVPVQFQRAAMLRDALFRDGGRDVSVRFTA
KVTSLDPSVKRFVLDIDGTQLAASGDAPNATAEFRWPSGKGTGQAHIELDPADGTPLRADGPWALFHVFD
GARVQQAGPADRFSVSFDGGKVVLSLVASSVNNAFRAGVLNAFRCPASL
 
Nucleotide Sequence: 3510 bp     [Download]
>gi|377807392|ref|NC_016590.1|:429392-432901 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGAAGTGGATCGATACCCTGAAGAAGCCTGCTGTCGTCTCATTCGCCGGCGTGCTCGCGCTGGTCGCGC
TCGTGTGGTTCTACGGGCCGCTCGTCGCCTTCGACGGACGCGCGCCGCTCGACAGCGCGGCACGCCGGTG
GCTCGCAGCCGCGCTGATCGTCCTGTGCTGGGCCGGATACTGGGGCGTGCGGTATGCCAAGGCGCGCATC
GCCGGGTCGAAGTTCGTGCAGGGTCTCGTCGCCGATGCGCTCGATCCCGCGCGGCGCGAGCCGGACCCCG
CCCGCCAGGCCGCCGATGCCGAACTGGCCACGCTGCGCACGCGTTTCGAAGACGCCCTCAGAACGCTGCG
CGAAACGCGTGGCGGCGCGAAGCAGGGTGTGGCCGGCTGGCTCAGGCCGCGCCGCGAAGCGCTCTACGAT
CTGCCGTGGTACATGTTCGTCGGCGCGCCCGGCGCGGGCAAGACCACCGCGCTTGCGCATTCCGGCCTGC
GTTTTCCGTTGGCGGACCGGCTGGGCGCGCAGGCGGTGGGCGGGGTCGGCGGCACGCGCAATTGCGACTG
GTGGTTCACCGACGACGCCGTGCTGCTCGATACCGCCGGCCGCTTCACGACGCAGGATAGCCATGAAGAA
GCGGATCGCGGCGCGTGGCTCGGCTTCCTCGCCCTGCTGCGCAAATATCGCCCGCGCCGCCCGCTGGATG
GCGTGATGGCCGTGGTGTCCGCCGCCGATCTGCTGCAGCAGTCCGACGAAGCGCGCGCCGCGCATGCGGT
GACCATCCGCGAGCGTCTGTCCGAACTGAACCGGCAACTCGGCGTGCGTCTGCCGGTGTACGTCGTCGTC
ACCAAGAGCGACATGCTCGCGGGCTTCTCCGAATACTTCGACGACTTCGGCCGCGACGAACGCGAACAGG
TCTGGGGCGTGACGTTTCCGCTCGCATCGGATCAGGGCGAAGCCGAGGCCGGCACACCGCTCGCGCGCTT
TCCCGACGAGTTCCGTCTGCTTCACCGCCAGGTGCAGGACCGCGTGCTGCAGCGCATGCAGCAGGAAACC
GACGTGCGCCGCCGCGCGCTGATTCATTCGTTCCCGCAGCAGTTCGCGGGCATCGAGCAGGCCTTGCAGC
GCTTTCTCGACGATGCTTTCGGCGATTCGCGCTTCTCCCGCGCGGCTTTGCTGCGCGGCGTCTACTTCAC
GAGCGGCACGCAAAGCGGCCGTCCGCTCGACCGCATGATGAGCGCCATGGCCGGCTCGCTCGGACTGCGC
CGCGAAGTCGTGATGGCGGATGCGTCGAGCGGACGTGCCTACTTCGTCAAGCGGCTGCTGCGTGACGTGA
TCTTCGCGGAGCAGGGCATCGCGGGCACGGATCCGCGCACGGAACGGCGGCGCACGCGCTTTCAGCGGAT
CGCCGTCGGCCTGATCGGCGTGTTGCTCGCGGCGGGGCTGGCCGGACTGATTGTCACCGACCGGCAGAAC
CGGCGTTTCGTCGAGGAAAGCCGTCAGCAGATCGCGGCGCTGGCGGAACGCGCGAAGCAGACGAGCGCCG
GCGACAGTCCGCTCGCCGTGCTGCCGCTGCTCGATGCCGCGCGCGACCTGCCCGGCGGCGACGCCGAGCG
CGCCTCGCGCGATCGGTCTTGGTGGGCGGGCTTCGGGCTCGATCAGCGCGAGAAGCTCGGGCTCGAAGCC
GAGCGCGTCTATCAGCGGCTGTTGCGGCAGACCTTGCTGCCGATCGTCGTAGAGCGCATGGAGGACCAGT
TGCGCCACGCCCAGTCGGAAGATACGGCGACGCTCTACGAGGCGCTGCGCGCGTATCTGATGCTGGGCGA
TCCGGCCCACTTCGACCCCGACGCACTGCAGGTCTGGGCGATGCGCACCTGGCGGCAGGGCGCCATGAAG
GACGCCAGCGACGCAGAGCGCGCGAACATCGAGCGTCACCTCCGGGCGCTGTTCAGCCGCGGACAGTTCG
ATTCGAACCTGCCGCTCGACCAGAGCCTGATTGCGCACGCGCGCGCCGTGCTGAATCGCGTGCCGCTGGC
GCAGCGGCTCGACGGACGCATCCAGCAGCAGCTTGCGCAGCAGCGCCTGCCGGAATTCACGGTCGCGAAG
GCGGCGGGTCCGAGCGGACAGATCGTGTTCGTCAGAAAGAGCGGCGTGCCGCTCACGCAGGGCATCGACG
GCGCCTATACGCGCGAGGGTTTCGCGGCGTTCGAGCGTCTGCGCGAAGCGGCGCTTGCGAATCTTCCCAA
AGACGACTGGGTGCTCGGCAACGGCCAGACCCGCGCCGGCGCGCAGGATACGGACGCGTTGCGCACCGCG
CTCACACGCCTCTATAGCGACGAGACCATTCGCCAATGGGACGCGCTGCTGGCGGATATCGGCGTCGTGC
CGTTCGATGCGCCGGATCAGGGCGCCCGCGTGGCGAACCTGCTCGGCGCGCCGAATTCGCCGCTACGCGC
GCTGATCGAAGGGATTGCGCGCGAAACGCGCTTCACGCCGCCCGCCGCGCAGCCCGGCAAGCTCGACACG
CTGCGCAAGCGCATCGGCGTCGAGACGGACGCGCCCGCCGCGCCGACGCTCGTCGATGCGCATTTCCAGG
CGCTGCACGATCTCGCCGGCGCACCGCTCGACGACTACGTCAACGCGCTGAAAGACGCCGCCGCGACCTT
GCAGGCGGAAGACACCGCGCGCAGGCAGTCCCTGCCGCTGCCCGCGACCGGGCCGCTGGACCGGCTCAAG
CTGATGTCGCAGAATGCGCCCGCGCCGCTTGCGGCCATCCTGCAGGGCGTCGCCGGCAACGCCGATACCG
TGCAGATCCAGAGCCAGCGGGCGCAGTTGCAGTCCGCGTGGGCGGCGAGCGTCGCGCCGGCGTGCAGACA
GGCGCTCGACGGGCGCTATCCGCTGGTGCGCGGCGCAGCGCGCGACGCAGCCCCCGACGATTTCGCGCGC
GTGCTCGCGCCAGGCGGCCTCGTCGATACGTTCTTCCAGCAGAATTTGCAGAGCCGCATCGACACGTCGG
GGGCGGTGTGGAAGTGGCGTCCCGAGGCGAAGGCGCTCGGTCTGTCGGACGACGTGCCGGTGCAGTTCCA
GCGTGCCGCGATGTTGCGCGATGCGCTGTTCCGCGACGGCGGCCGCGATGTGTCCGTTCGCTTCACGGCG
AAAGTCACGTCGCTCGATCCGTCGGTGAAGCGCTTCGTGCTCGATATCGACGGCACGCAGCTCGCCGCCT
CGGGCGACGCGCCCAACGCCACGGCCGAGTTTCGCTGGCCGAGCGGCAAGGGCACGGGGCAGGCCCATAT
CGAACTCGATCCCGCCGACGGTACGCCGTTGCGCGCGGACGGACCGTGGGCGCTGTTTCATGTGTTCGAC
GGTGCGCGGGTGCAGCAGGCCGGGCCAGCCGATCGCTTCAGCGTGTCGTTCGATGGCGGCAAGGTCGTGC
TGTCGCTCGTCGCCAGCAGCGTGAACAATGCGTTCCGCGCGGGCGTCCTGAATGCCTTCCGCTGCCCGGC
TTCGTTATGA
 Primer design