SecReT6
Protein ID: 377810738
SecReT6 ID527
T6SS typei3
Gene symbolicmF
Locus tagBYI23_D001450
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]167574..171209 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDG8MKN3
KEGG IDbyi:BYI23_D001450
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 7.30E-96, Aligned region: 212..478
IcmF-related [PF06761], Evalue: 8.70E-92, Aligned region: 525..838
DUF1215 [PF06744], Evalue: 8.20E-33, Aligned region: 946..1070
Protein Sequence: 1211 a.a.     [Download]
>gi|377810738|ref|YP_005043178.1| type VI secretion protein IcmF [Burkholderia sp. YI23]
MNMKKLFAMVFQPLVLLVVGMLLIAGAIWIAGPLVSFAGAYPLERREARFMAIGCVALLFVLRRIWVAWS
ARRTQAALASGLVAPLPVPRAATAAPTPGEAEVATLAKRFDEALAALRSARLAASGRKPGWRDWITLSGR
QYLYQLPWYMFIGAPGAGKTTALVHSGLRFPLAERFGTDKIRGVGGTRNCDWWFTDDAVLIDTAGRYTTH
ESDRDTDQAAWQGFLALLRKTRPRQPINGVLLTLAVPDLLAATPARTEVMAATLRARLHELTEALRTCFP
VYVLVTKTDLLAGFTEFFADMSKEERAQVFGFTFPYDAKRPLDEAEFAARIDTELDALEARLVARLPDRL
NAEPGLAQRAAIVGFPQQFAALKPLLAEALRATFMQSRHDDLSFVRGVYFTSGTQEGAPIDRVMGALARA
FGIERGVQPARAPAGRSFFLERLLTQVVFAEQGLAGSNLQWSRRRHVWRLSAYAAIAAAGACVLALWGVS
YVRNETYVASVDRAAHAARQVAAGTSAAGASVAALLPLLSAVRDLASTPQVDAAHPPLAMQLGLWQGAKL
DAAARGAYERLLTDLFLPKLAARIEEQARGANPANPGYAYESLKAYLMMNQPDHQDADALKTWIVSDWDR
TLPREVGNAERAALAAHLDTLFARGVVHPNLPFDERLVAHLRGMLATSTLAQRVYGRVKQQGVGADYPEF
TVARAGGPNASLVFVRSSGKPLTSGVPGLYSFDGYHKAFLAAVDQVSAQLAAEEPWVLGIRDQSGLPRGD
PAAMQRLTEDVRLLYLQDYARTWSDFLNDVRIVRSDTLAQSVQIARILSAPDSPLAMLVKAAARETTLAA
KPATETTVVDKASDKLTAAREQLEKIIRGPDPTRIAPVAPGTRLESIVDDRFSGLRALVTSPGSGEPAPI
AQTLALLNDIYTYLSATDQALQQKTAPPPSDAPAKLRAQAPRLPEPIRTALLELGSQGAAQTQQARRVNL
SADLKESISAFCKRAVSGRYPFNPESARDVPPEDFGALFAPGGKFDDFFQKNLAPDVDISAKPWAFKKSD
SSAAQISSAGLAQFERAATIRSVLFRAGGKTPGLALQLKPLDMDPTILSFTLDIDGQVLTYAHGPQIATA
IQWPGTRGSGRVSVQLTPPPPGGAGNLVFEGPWALFRMFDRLGVQPTAQPERFIVTFDVEGRKARFEVTA
NSVENPFRLADLRAFSCPERL
 
Nucleotide Sequence: 3636 bp     [Download]
>gi|377810593|ref|NC_016626.1|:c171209-167574 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
CTGAACATGAAAAAACTCTTTGCGATGGTGTTTCAGCCACTGGTCCTGCTCGTCGTCGGGATGCTGCTCA
TCGCGGGCGCGATCTGGATCGCCGGGCCGCTCGTGTCGTTCGCGGGCGCGTATCCGCTCGAACGGCGCGA
GGCGCGCTTCATGGCGATCGGCTGTGTCGCGCTGCTGTTCGTGCTGAGGCGCATCTGGGTTGCGTGGAGC
GCGCGGCGCACGCAGGCCGCGCTCGCCTCGGGACTCGTCGCGCCGCTTCCCGTGCCGCGCGCCGCGACCG
CCGCGCCCACGCCGGGCGAAGCCGAAGTCGCGACGCTCGCCAAACGCTTCGACGAGGCACTCGCCGCGCT
GCGCTCCGCGCGGCTCGCGGCGTCGGGCAGAAAGCCGGGCTGGCGCGACTGGATCACGCTGTCGGGCCGG
CAATACCTGTATCAGTTGCCGTGGTACATGTTCATCGGCGCGCCGGGCGCGGGCAAGACGACCGCGCTGG
TGCATTCCGGCCTGCGCTTTCCTCTGGCCGAGCGCTTTGGCACCGACAAGATCCGCGGCGTCGGCGGCAC
GCGCAACTGCGACTGGTGGTTCACCGACGACGCCGTGCTGATCGACACCGCCGGCCGCTACACGACCCAC
GAAAGCGACCGCGACACGGATCAGGCCGCGTGGCAGGGCTTTCTCGCGCTGCTGCGCAAGACGCGCCCGC
GCCAGCCGATCAACGGCGTGCTCCTGACGCTCGCCGTGCCCGACCTGCTCGCCGCCACGCCCGCGCGCAC
CGAAGTCATGGCGGCGACGCTGCGCGCGCGCCTGCACGAGCTGACGGAGGCGTTGCGCACGTGCTTTCCG
GTCTACGTGCTGGTCACGAAGACGGACCTGCTCGCGGGCTTCACGGAGTTTTTCGCGGACATGTCGAAGG
AAGAGCGCGCGCAGGTCTTCGGCTTCACCTTTCCCTACGATGCGAAGCGCCCGCTCGACGAAGCCGAGTT
CGCCGCGCGCATCGACACGGAACTCGATGCGCTCGAAGCGCGCCTCGTCGCTCGCCTGCCCGACCGGCTG
AACGCCGAGCCCGGCCTCGCGCAGCGCGCCGCCATCGTGGGTTTCCCGCAGCAGTTCGCCGCGCTCAAGC
CGCTTCTCGCCGAGGCCTTGCGCGCGACCTTCATGCAGTCCCGCCACGACGACCTTTCGTTCGTGCGCGG
CGTCTACTTCACGAGCGGCACGCAGGAAGGCGCGCCGATCGACCGTGTGATGGGCGCACTCGCGCGCGCC
TTCGGCATCGAGCGCGGTGTGCAGCCCGCGCGTGCGCCGGCGGGGCGCAGCTTCTTTCTGGAACGGCTGC
TCACGCAGGTGGTGTTCGCGGAGCAGGGCCTGGCCGGGTCGAACCTGCAATGGTCGCGGCGCAGGCATGT
CTGGCGGCTCTCGGCGTATGCGGCGATCGCGGCGGCGGGCGCGTGCGTGCTCGCGCTCTGGGGCGTGAGC
TATGTGCGCAACGAGACGTACGTTGCCAGCGTCGACCGGGCCGCGCACGCGGCGCGGCAGGTGGCCGCGG
GCACGTCGGCGGCGGGCGCGAGCGTCGCCGCGCTGCTGCCGCTGCTCTCGGCGGTGCGCGATCTCGCCTC
GACGCCGCAGGTCGATGCCGCGCATCCGCCGCTCGCGATGCAACTCGGCCTGTGGCAAGGCGCGAAACTC
GACGCCGCCGCGCGCGGCGCGTACGAGCGCCTGCTCACCGATCTGTTTCTGCCGAAGCTCGCGGCGCGCA
TCGAGGAGCAGGCGCGCGGCGCGAACCCCGCCAATCCCGGCTACGCGTACGAGTCGCTCAAGGCTTATCT
GATGATGAACCAGCCCGATCATCAGGATGCCGATGCACTCAAAACCTGGATCGTCAGCGACTGGGACCGC
ACGCTGCCGCGCGAAGTCGGCAATGCGGAGCGCGCCGCGCTCGCCGCGCATCTCGACACGCTCTTCGCAC
GCGGCGTCGTGCATCCGAATCTGCCGTTCGACGAGCGGCTCGTCGCGCATCTGCGCGGCATGCTCGCCAC
CAGCACGCTCGCGCAGCGCGTGTACGGGCGGGTGAAGCAGCAAGGCGTGGGCGCGGACTATCCGGAGTTC
ACCGTGGCGCGCGCGGGCGGGCCCAACGCGTCGCTCGTGTTCGTGCGTTCGAGCGGCAAGCCGCTCACGA
GCGGCGTGCCCGGCCTGTATTCGTTCGACGGCTATCACAAGGCGTTTCTTGCGGCCGTCGATCAGGTCTC
GGCGCAGCTTGCCGCCGAAGAGCCGTGGGTGCTCGGCATCCGCGATCAAAGCGGCCTGCCGCGCGGCGAT
CCGGCTGCCATGCAGCGCCTTACCGAAGACGTCCGGCTGCTGTATCTGCAAGACTACGCGCGCACCTGGA
GCGACTTCCTGAACGACGTCCGCATCGTGCGCTCGGACACGCTCGCGCAATCGGTGCAGATCGCGCGCAT
TCTGTCCGCGCCCGATTCGCCGCTCGCCATGCTCGTGAAGGCGGCTGCGCGCGAAACCACGCTCGCCGCG
AAGCCCGCGACGGAGACGACCGTCGTCGACAAGGCGAGCGACAAGCTCACCGCTGCGCGCGAGCAACTGG
AGAAGATCATTCGCGGGCCCGATCCCACGCGTATCGCGCCGGTCGCGCCGGGCACGCGTCTGGAAAGCAT
CGTCGATGACCGCTTCAGCGGACTGCGCGCGCTGGTGACGAGCCCGGGCTCAGGCGAGCCCGCGCCCATC
GCGCAGACGCTCGCGCTGCTCAACGACATCTACACGTATCTGAGCGCCACCGATCAGGCGTTGCAGCAGA
AAACCGCGCCGCCGCCCTCGGATGCGCCCGCGAAGCTGCGCGCGCAGGCGCCGCGTCTGCCCGAGCCGAT
CCGCACCGCGCTCCTGGAACTCGGCAGCCAGGGCGCGGCGCAGACGCAGCAGGCGCGGCGCGTGAATCTC
TCGGCAGATCTGAAGGAGTCGATTTCGGCGTTCTGCAAGCGGGCCGTGAGCGGGCGCTATCCGTTCAATC
CGGAATCCGCGCGCGATGTGCCGCCCGAGGACTTCGGCGCGCTCTTCGCGCCCGGCGGCAAGTTCGACGA
TTTCTTTCAGAAGAACCTCGCGCCCGACGTCGATATCTCCGCGAAACCCTGGGCCTTCAAGAAATCGGAT
TCGTCGGCGGCGCAGATCAGTTCGGCGGGGCTCGCGCAATTCGAGCGCGCCGCGACGATCCGCAGCGTGC
TCTTTCGCGCGGGCGGCAAGACGCCCGGGCTCGCCTTGCAGTTGAAGCCGCTCGACATGGACCCGACGAT
TCTGTCCTTCACGCTCGACATCGACGGGCAAGTGCTCACCTACGCGCACGGGCCGCAGATCGCCACCGCG
ATCCAGTGGCCGGGCACGCGCGGCTCGGGCCGCGTGAGCGTGCAACTGACGCCGCCGCCGCCGGGCGGCG
CGGGCAATCTGGTCTTCGAAGGGCCGTGGGCGCTCTTTCGCATGTTCGACCGGCTGGGCGTGCAACCGAC
CGCGCAGCCCGAGCGTTTCATCGTGACTTTCGATGTCGAGGGCCGCAAGGCGCGTTTCGAAGTGACGGCG
AACAGCGTCGAGAATCCGTTCCGCCTCGCGGATCTGCGCGCGTTTTCCTGCCCGGAACGCCTATGA
 Primer design