SecReT6
Protein ID: 377810739
SecReT6 ID527
T6SS typei3
Gene symbol-
Locus tagBYI23_D001460
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]171206..172549 [-]
Producttype IV / vi secretion system protein, dotu family
NoteTssL
UniProt IDG8MKN4
KEGG IDbyi:BYI23_D001460
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.00E-69, Aligned region: 71..275
OmpA [PF00691], Evalue: 2.30E-17, Aligned region: 339..435
Lipase_GDSL_2 [PF13472], Evalue: 5.60E-06, Aligned region: 101..226
Lipase_GDSL_2 [PF13472], Evalue: 5.60E-06, Aligned region: 312..409
Protein Sequence: 447 a.a.     [Download]
>gi|377810739|ref|YP_005043179.1| type IV / vi secretion system protein, dotu family [Burkholderia sp. YI23]
MRPLRPPKPSSAMSNDDDPFAGFESDQTMIKPNPGARRRTGNTQGPFTPGAAADAGVHAFDAAFTQGGAV
NPLVAACAPLLQLAPRIRTMSACDDPAALRDSLAAGVRRFEAQARVNGVAAEQVTAARYIVCTMLDEAAA
GTPWGAGVWARQSLLVTFHNEAWGGEKVFQLLARLAQQPARHLHLLELASVVLALGFEGRYRVAAQGRQA
LDAIRARLHQLIRKERGEHERALSPHWEGVPTTRRRTTDVLPVWVVGAFALLVLAAAYMTMSFRLGRLSD
PAFDALASIRAGVQRPLVVTQAAKPRLAEFLAQEIRDGQLAVDDRVDRSVVTLHGDNVFRPGSAEVAAPV
RPLIERIGAALAAVPGNVLVTGHTDDRPIRSARYPSNWELSQERAANVRDLLAASVPPARLKAEGKGDAD
PVAPNDSPAGRARNRRVEVTLFAKPGP
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|377810593|ref|NC_016626.1|:c172549-171206 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
CTGAGGCCACTAAGGCCACCGAAACCATCGAGCGCCATGAGCAACGACGACGATCCCTTCGCCGGATTCG
AATCCGACCAGACGATGATCAAGCCCAATCCCGGCGCACGCCGCCGCACCGGGAACACGCAAGGGCCCTT
CACGCCGGGCGCGGCTGCCGATGCGGGCGTGCATGCCTTCGATGCCGCGTTCACGCAGGGCGGCGCGGTC
AATCCGCTGGTCGCCGCGTGCGCGCCGCTGTTGCAGCTTGCGCCGCGCATCCGCACCATGAGCGCCTGCG
ACGATCCCGCCGCGCTGCGCGATTCGCTCGCGGCGGGCGTGCGCCGCTTCGAGGCGCAGGCGCGCGTCAA
CGGCGTCGCGGCGGAACAGGTGACGGCGGCGCGCTACATCGTCTGCACGATGCTCGACGAAGCCGCCGCG
GGCACGCCGTGGGGCGCGGGCGTGTGGGCGCGCCAGAGCCTGCTCGTGACGTTTCATAACGAAGCATGGG
GCGGCGAGAAGGTGTTCCAGCTGCTCGCCCGCCTCGCGCAGCAGCCCGCCCGGCATCTGCATCTGCTGGA
GCTGGCGAGCGTGGTGCTCGCGCTCGGCTTCGAGGGACGCTATCGCGTGGCGGCGCAGGGCAGACAGGCG
CTCGATGCGATCCGCGCGCGGCTTCATCAACTGATCCGCAAGGAGCGCGGCGAGCACGAACGCGCGCTGT
CGCCGCATTGGGAAGGCGTGCCGACGACGCGGCGGCGCACGACCGACGTGCTGCCGGTGTGGGTGGTCGG
CGCGTTCGCGCTGCTCGTGCTCGCGGCGGCTTATATGACGATGAGTTTCCGCCTCGGCCGCCTGTCCGAT
CCAGCCTTCGATGCGCTCGCGTCGATCCGCGCGGGCGTGCAGCGGCCGCTCGTCGTCACGCAGGCGGCCA
AGCCCCGTCTCGCCGAATTTCTCGCGCAGGAGATCCGCGATGGCCAACTGGCCGTCGATGACCGCGTGGA
CCGCTCGGTCGTCACGCTGCACGGCGACAACGTGTTCAGGCCCGGCAGCGCGGAAGTGGCGGCGCCGGTG
CGCCCGCTCATCGAGCGCATCGGCGCGGCGCTCGCGGCGGTGCCGGGCAACGTGCTCGTGACGGGCCATA
CGGACGACCGGCCGATCCGCTCGGCGCGCTATCCGTCGAACTGGGAACTGTCGCAGGAGCGCGCCGCGAA
CGTGCGCGACCTGCTCGCGGCGAGCGTGCCGCCCGCGCGCCTGAAGGCCGAGGGCAAGGGCGATGCGGAT
CCCGTCGCACCCAACGATTCGCCCGCCGGACGCGCGCGCAACCGGCGCGTCGAAGTGACGCTGTTCGCGA
AGCCGGGGCCCTGA
 Primer design