SecReT6
Protein ID: 377810740
SecReT6 ID527
T6SS typei3
Gene symbol-
Locus tagBYI23_D001470
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]172546..173916 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDG8MKN5
KEGG IDbyi:BYI23_D001470
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.20E-149, Aligned region: 19..455
Protein Sequence: 456 a.a.     [Download]
>gi|377810740|ref|YP_005043180.1| type VI secretion protein [Burkholderia sp. YI23]
MTWNQRMIWSEGLFLEPQHFQQQDRFFEHLVRSHARATQAWSWGWASVMLDDIALGLGKVALASAFGVLP
DGTAFSFPDDAPAPPPLDIPADARDETVLLALPLARVGAMESDPNHATPDATPDAAPEDGRAGALRYRTT
DTSVADVTTSGERVAQLRVGAPNLRLMLARDATDAFATIGIARVLERRADNRVMLDTAYIPPMLHALADA
RLAGYAQEIAGLLHQHADRLARHIANPGRGGVAEIADFLLLQTLNRFEPQFAHLLDVPLLHPERLYQTTL
ALAGDLAAFDERRRVLAYPPYRHDDLASSFEPLMRDVRQLLAQVPEPNAIAIELQTRKPGLRVAVISDLD
LVRTAGFVLAASAQMPGEALRTRFPSQVKVAPAEKLRDLVNLALPGIGLRAMPVAPRQIPFHAGCSYFEL
DRGGELWKELEQTGNLAMYIAGEFPALELEFWAIRH
 
Nucleotide Sequence: 1371 bp     [Download]
>gi|377810593|ref|NC_016626.1|:c173916-172546 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
ATGACCTGGAACCAGCGCATGATCTGGTCCGAGGGGCTGTTCCTCGAACCACAGCATTTCCAGCAGCAGG
ACCGCTTCTTCGAGCATCTCGTGCGCTCGCATGCGCGGGCGACGCAGGCGTGGTCCTGGGGCTGGGCGTC
CGTGATGCTCGACGACATCGCGCTCGGGCTCGGCAAGGTCGCGCTCGCCTCCGCGTTCGGCGTGTTGCCC
GACGGCACCGCGTTCTCCTTTCCCGACGACGCGCCCGCGCCGCCGCCGCTCGATATCCCCGCGGACGCGC
GCGACGAAACCGTGCTGCTCGCGCTGCCGCTCGCGCGCGTGGGGGCCATGGAGTCCGATCCCAATCACGC
CACACCCGACGCCACACCCGACGCCGCACCCGAAGACGGCCGCGCAGGCGCGCTGCGTTACCGCACCACC
GATACCTCCGTCGCCGATGTCACCACCAGCGGCGAGCGCGTCGCGCAGCTTCGCGTCGGCGCGCCGAACC
TGCGGCTCATGCTCGCGCGCGACGCCACCGACGCCTTCGCGACCATCGGCATCGCGCGCGTGCTGGAGCG
GCGCGCGGACAACCGCGTGATGCTCGACACCGCCTATATCCCGCCGATGCTTCATGCCCTCGCCGATGCG
CGTCTTGCCGGTTACGCACAGGAAATCGCGGGACTGCTGCATCAGCACGCGGACCGGCTCGCGCGCCATA
TCGCCAATCCGGGGCGCGGCGGCGTCGCCGAGATCGCCGACTTTCTGCTGCTGCAAACGCTGAACCGTTT
CGAGCCGCAGTTCGCGCATCTGCTGGATGTGCCGCTCCTGCATCCCGAGCGGCTCTATCAGACGACGCTC
GCGCTCGCGGGCGATCTCGCCGCGTTCGACGAGCGCCGCCGCGTGCTCGCCTATCCGCCCTACCGTCACG
ACGATCTGGCCAGTTCCTTCGAGCCGCTCATGCGCGACGTGCGGCAGTTGCTCGCGCAGGTGCCGGAGCC
GAACGCCATCGCCATCGAATTGCAGACCCGAAAGCCGGGCCTGCGCGTGGCCGTCATCAGCGATCTCGAT
CTGGTGCGCACGGCGGGCTTCGTGCTCGCCGCCAGCGCGCAGATGCCGGGCGAGGCGCTGCGCACGCGCT
TTCCGTCCCAGGTGAAAGTCGCGCCCGCCGAGAAGCTGCGCGATCTGGTGAATCTCGCGCTGCCGGGCAT
CGGGCTGCGCGCGATGCCGGTCGCGCCGCGCCAGATTCCGTTTCACGCGGGCTGTTCGTACTTCGAACTG
GATCGCGGCGGCGAGCTATGGAAGGAGCTGGAGCAGACCGGCAACCTCGCGATGTATATCGCCGGCGAGT
TTCCCGCGCTGGAGCTGGAGTTCTGGGCTATCCGCCACTGA
 Primer design