SecReT6
Protein ID: 377810741
SecReT6 ID527
T6SS typei3
Gene symbol-
Locus tagBYI23_D001480
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]174037..174561 [-]
Producthypothetical protein
NoteTssJ
UniProt IDG8MKN6
KEGG IDbyi:BYI23_D001480
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 9.20E-41, Aligned region: 19..153
Protein Sequence: 174 a.a.     [Download]
>gi|377810741|ref|YP_005043181.1| hypothetical protein BYI23_D001480 [Burkholderia sp. YI23]
MRRVEPVSRVLSFVVLAGALAVAACKSAPPPPPPPTIVRIDVSALNKVNPDHSGRPSPVLVRVYELKATA
AFDSADFFTLYGKDQATLGADLNAKNEFLLKPGEKQSIEQAAQPGTKFVAVVAAYRDIEHARWRAAVPVP
PNQTTVMSVRIDTADVSIAAQRATPPPPSRAAKK
 
Nucleotide Sequence: 525 bp     [Download]
>gi|377810593|ref|NC_016626.1|:c174561-174037 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
ATGAGAAGAGTCGAGCCAGTGTCGCGCGTGCTTTCGTTCGTCGTCTTAGCGGGCGCGCTCGCCGTCGCGG
CGTGCAAATCCGCGCCGCCTCCTCCGCCCCCGCCGACGATCGTGCGCATCGACGTGAGCGCGCTCAACAA
AGTGAATCCGGATCACAGCGGCCGGCCCTCGCCCGTGCTCGTTCGCGTGTACGAACTGAAGGCGACCGCC
GCCTTCGACAGCGCCGACTTCTTCACGCTCTACGGCAAGGACCAGGCGACGCTCGGCGCGGACCTCAACG
CGAAGAACGAATTCCTGCTCAAGCCCGGCGAGAAGCAAAGCATCGAACAGGCGGCGCAGCCGGGCACGAA
GTTCGTCGCGGTCGTGGCGGCCTACCGCGACATCGAACACGCGCGCTGGCGCGCCGCCGTGCCCGTGCCG
CCGAACCAGACGACCGTGATGAGCGTGCGCATCGACACCGCCGATGTCTCGATCGCCGCGCAGCGCGCGA
CCCCGCCGCCGCCGTCGCGCGCCGCCAAAAAATGA
 Primer design