SecReT6
Protein ID: 377810745
SecReT6 ID527
T6SS typei3
Gene symbolimpA
Locus tagBYI23_D001520
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]185833..186843 [+]
Productprotein ImpA
NoteTssA
UniProt IDG8MKP0
KEGG IDbyi:BYI23_D001520
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.40E-21, Aligned region: 51..110
Protein Sequence: 336 a.a.     [Download]
>gi|377810745|ref|YP_005043185.1| protein ImpA [Burkholderia sp. YI23]
MIDVEPLLAPTETMPPAGIDLEYDPAFLALDALARGNPERQFEALAEPTAWPDVLEASQALLAKSKDLRI
GVVYARAASRVHGLAGFHAGLRLLTGLFERYWDTLYPPLDADDDNDPALRVNALAPLADAYTPFAESETL
LHDLRESEVCRARGERLTVRDMLVAQGRLAAAQGESAATPARVEGMLADALARDRDTLAEGLDLPRAVQA
LSDALTGRLGAERAPLLADMLGTARLVAAQMHAAAPQAEPQTVTAPQAGVERRATARPGEIATREDAVAL
LDSVCAFLERTEPAHPAPLLIRRARGLMGKDFLSVMRDLAPGSLDQIHLIAGTKPE
 
Nucleotide Sequence: 1011 bp     [Download]
>gi|377810593|ref|NC_016626.1|:185833-186843 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
ATGATCGACGTCGAACCTCTACTAGCGCCGACCGAGACGATGCCGCCCGCGGGCATCGATCTCGAATACG
ACCCGGCGTTTCTCGCGCTCGATGCGCTCGCGCGCGGCAATCCCGAGCGCCAGTTCGAAGCGCTCGCCGA
GCCGACCGCATGGCCGGACGTGCTGGAAGCGTCGCAGGCGCTGCTCGCGAAGTCGAAGGATCTGCGCATC
GGCGTGGTCTATGCGCGCGCGGCCTCGCGTGTGCACGGCCTCGCGGGTTTCCATGCGGGCTTGCGCCTCC
TGACCGGGCTGTTCGAGCGCTACTGGGACACCCTCTATCCGCCGCTCGATGCCGACGACGACAACGATCC
CGCGCTGCGCGTCAACGCGCTCGCGCCCCTCGCCGATGCGTACACGCCGTTCGCTGAAAGCGAAACGCTG
CTGCACGATTTGCGGGAGTCCGAAGTGTGCCGCGCGCGCGGCGAACGGCTGACCGTGCGCGATATGCTCG
TCGCGCAGGGAAGGCTGGCGGCGGCACAAGGCGAGAGCGCGGCGACGCCCGCGCGCGTCGAAGGCATGCT
CGCCGATGCGCTCGCGCGGGATCGCGACACGCTCGCCGAAGGCCTCGATCTGCCGCGCGCCGTGCAGGCG
CTCTCCGATGCGCTGACCGGCCGGCTCGGCGCGGAACGCGCGCCGCTGCTCGCGGACATGCTGGGCACGG
CGCGTCTCGTGGCCGCGCAAATGCACGCGGCGGCGCCTCAGGCGGAGCCCCAAACCGTAACCGCGCCGCA
AGCGGGCGTCGAAAGACGCGCGACCGCGCGGCCTGGCGAGATCGCCACGCGTGAAGACGCCGTTGCGCTG
CTCGATTCGGTTTGCGCGTTCCTGGAGCGCACCGAGCCCGCGCATCCCGCACCGCTTTTGATTCGCCGGG
CGCGCGGGCTGATGGGCAAGGATTTTCTCTCTGTGATGCGCGATCTCGCGCCCGGCAGCCTCGACCAGAT
TCATTTGATCGCGGGGACCAAGCCGGAGTGA
 Primer design