SecReT6
Protein ID: 377810746
SecReT6 ID527
T6SS typei3
Gene symbolsciH
Locus tagBYI23_D001530
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]186923..187459 [+]
Producthypothetical protein
NoteTssB
UniProt IDG8MKP1
KEGG IDbyi:BYI23_D001530
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.80E-59, Aligned region: 9..161
Protein Sequence: 178 a.a.     [Download]
>gi|377810746|ref|YP_005043186.1| hypothetical protein BYI23_D001530 [Burkholderia sp. YI23]
MATSSQKFIGRNRAPRVQIEYDVETYGSEKKVQLPFVMGVMADLSGKPAEPLPPVDQRKFQEIDIDNFDS
RMKAMHPRVAFQVPNRLTGEGNLSVDITFDNMSDFSPAAVARKVDALGKLLEARTQLANLVIFMDGKTGA
EELIARVLDDPALLKTLASAAPAANDATAADAAAKPAE
 
Nucleotide Sequence: 537 bp     [Download]
>gi|377810593|ref|NC_016626.1|:186923-187459 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
ATGGCAACCAGCAGTCAGAAATTCATCGGCCGCAATCGCGCGCCGCGCGTTCAGATCGAATACGACGTCG
AAACCTACGGCAGCGAGAAGAAGGTCCAGCTTCCGTTCGTGATGGGCGTCATGGCCGATCTTTCCGGCAA
ACCCGCCGAGCCGCTGCCGCCCGTCGACCAGCGCAAATTCCAGGAGATCGACATCGACAACTTCGACAGC
CGCATGAAGGCGATGCATCCGCGCGTCGCGTTCCAGGTGCCGAACAGGCTGACCGGCGAGGGCAATCTGA
GCGTCGATATCACCTTCGACAACATGAGCGACTTCTCGCCCGCCGCCGTCGCGCGCAAGGTCGATGCGCT
CGGCAAGCTGCTCGAAGCGCGCACCCAGCTCGCCAATCTCGTCATCTTCATGGACGGGAAGACGGGCGCG
GAAGAACTGATCGCGCGCGTGCTCGACGATCCCGCGCTGCTCAAGACGCTCGCGTCCGCCGCGCCGGCCG
CGAACGATGCCACCGCCGCCGATGCCGCCGCAAAGCCCGCCGAATGA
 Primer design