SecReT6
Protein ID: 377810747
SecReT6 ID527
T6SS typei3
Gene symbol-
Locus tagBYI23_D001540
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]187498..188985 [+]
Producthypothetical protein
NoteTssC
UniProt IDG8MKX2
KEGG IDbyi:BYI23_D001540
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.30E-194, Aligned region: 63..489
Protein Sequence: 495 a.a.     [Download]
>gi|377810747|ref|YP_005043187.1| hypothetical protein BYI23_D001540 [Burkholderia sp. YI23]
MTEAKPDLQGATLEGSDLESLLNREFRPKSDEAKSAVQMAVQTLAQQALSQTQIISGDAIRSIQSMIAEI
DKKLTDQVNEVIHHADFQKLEGSWRGLHYLINNTETDEMLKIRVMNISKKDLGKTLKRFKGVAWDQSPLF
KQIYEHEYGQLGGEPIGALCGDFYFNQSPPDVELLGEMSKIAAAAHAPFIAAADPSLLQMDSWQELANPR
DLTKIFGTPEYASWRSLRASEDARYIGLAMPRFLARVPYGARTEPVDEFDFEEDTNSADHTKYTWANSAY
AMAVNITRSFKLYSWCSRIRGVESGGAVEGLPVHSFPTDDGGVDMKCPTEIAISDRREAELAKNGFMPLI
HRKNSDFAAFIGAQSLQKPFEYEDPDATANAALAARLPYLFACNRFAHYLKCIVRDKVGSFKERADMETW
LNKWITQYVDGDPANSSEHTKAQKPLAAAEVKVQEVPGAPGYYTSQFFLRPHYQLEGLTVSLRLVSRLPS
AKQAA
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|377810593|ref|NC_016626.1|:187498-188985 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
ATGACCGAAGCGAAACCCGACCTGCAGGGCGCGACGCTCGAAGGCAGCGATCTCGAATCGCTGCTGAACC
GGGAGTTCCGCCCGAAGAGCGACGAGGCGAAGTCCGCCGTGCAAATGGCGGTGCAGACGCTCGCGCAACA
GGCGCTCTCGCAGACGCAGATCATCTCCGGCGACGCTATCCGCTCGATCCAGTCGATGATTGCCGAAATC
GACAAGAAGCTCACCGATCAGGTGAACGAGGTGATCCATCACGCCGACTTCCAGAAGCTGGAAGGCTCCT
GGCGCGGGCTGCACTATCTCATCAACAACACCGAAACCGACGAGATGCTCAAGATTCGCGTGATGAATAT
CTCGAAGAAGGATCTCGGCAAGACGCTCAAGCGCTTCAAGGGCGTTGCGTGGGACCAGAGCCCGCTCTTC
AAGCAGATTTACGAGCACGAATACGGGCAGCTCGGCGGCGAGCCGATCGGCGCGCTGTGCGGCGACTTCT
ACTTCAATCAGTCGCCGCCCGATGTCGAACTGCTCGGCGAGATGTCGAAGATCGCGGCGGCGGCGCACGC
GCCGTTCATCGCCGCGGCCGATCCGAGCTTGTTGCAGATGGACTCGTGGCAGGAGCTTGCCAATCCGCGC
GATCTCACGAAGATATTCGGCACGCCGGAGTATGCGAGCTGGCGTTCGCTGCGCGCATCGGAAGACGCGC
GCTACATCGGCCTTGCGATGCCGCGCTTTCTGGCGCGCGTGCCGTACGGCGCGCGCACCGAGCCCGTCGA
CGAATTCGATTTCGAGGAAGACACCAACTCCGCCGATCACACCAAGTACACCTGGGCCAACTCGGCCTAC
GCGATGGCCGTGAACATTACCCGCTCGTTCAAGCTGTATAGCTGGTGCTCGCGCATTCGCGGCGTGGAGT
CGGGCGGCGCGGTGGAGGGCTTGCCCGTGCATAGCTTTCCGACCGACGACGGCGGCGTGGACATGAAGTG
CCCGACTGAAATCGCCATTTCGGACCGGCGCGAAGCCGAACTCGCGAAGAACGGCTTCATGCCGCTGATT
CATCGCAAGAACTCGGATTTCGCGGCGTTCATCGGCGCGCAGTCGTTGCAGAAGCCGTTCGAATACGAAG
ACCCCGACGCCACCGCGAATGCCGCGCTTGCCGCGCGCCTGCCGTATCTGTTCGCGTGCAACCGCTTCGC
GCATTACCTGAAGTGCATCGTGCGCGACAAGGTCGGCAGCTTCAAGGAACGCGCCGATATGGAAACCTGG
CTCAACAAGTGGATCACTCAATATGTGGACGGCGATCCGGCTAATTCGTCCGAGCACACCAAGGCGCAGA
AGCCGCTTGCCGCCGCCGAGGTGAAGGTGCAGGAAGTGCCGGGCGCGCCGGGCTATTACACGTCGCAGTT
CTTCCTGCGCCCGCATTATCAGCTCGAAGGGCTTACCGTGTCGTTGCGGCTGGTTTCGCGGTTGCCGTCG
GCGAAGCAGGCGGCTTGA
 Primer design