SecReT6
Protein ID: 377810749
SecReT6 ID527
T6SS typei3
Gene symbol-
Locus tagBYI23_D001560
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]189818..191185 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDG8MKX4
KEGG IDbyi:BYI23_D001560
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.30E-15, Aligned region: 28..94
Protein Sequence: 455 a.a.     [Download]
>gi|377810749|ref|YP_005043189.1| FHA domain-containing protein [Burkholderia sp. YI23]
MLKLTVIRHNGQPPRRPLAASFDAGGGTIGRAVTNRLVLDDAERTVSRMHAQIVWREGTYRLIDRGSNPA
LVNGAPLDPGEEVRIAHGDEVQIGGYQLRAEVAAEDDTQNARAMPDATTYAASDDPFAGLFDACAAPSVV
HASTLAPPDADVVCGGFELGLDDPASKRTIDELFDLAPGAHLSTDAPMDALVEPLTQPNTAHADDPFASL
TGAQPAAPRATLSDAGPELRSAFTPPRPRAAPTPTPALTPAETQTGDNALIDAFLQGLSAPGVRLDALTP
ELMRLIGELLHEATQGTLDLLAARAAFKREMRTDATIIAAADNNPLKFSPNVEAALAHLFGPPVRGFMPP
AAALADAHADLRAHQVGMVAGMRAALDGVFERFEPKRIEARLSGHSMLDGLLPGINRRARCWDRFMETYG
QLSNEATEDFHVLFGRAFVAAYEAQINELKRRGRP
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|377810593|ref|NC_016626.1|:c191185-189818 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
ATGCTCAAACTCACGGTGATACGTCACAACGGCCAGCCGCCGCGCAGGCCCCTCGCGGCGAGCTTCGATG
CGGGCGGCGGCACGATCGGGCGCGCGGTCACGAACCGTCTCGTGCTCGACGACGCCGAGCGCACCGTCTC
GCGCATGCATGCGCAGATCGTGTGGCGCGAAGGCACGTACCGGCTGATCGACCGCGGCAGCAATCCGGCG
CTCGTCAACGGCGCGCCGCTCGACCCCGGCGAGGAAGTGCGGATCGCCCACGGCGACGAAGTGCAGATCG
GCGGCTATCAACTGCGCGCGGAAGTCGCCGCCGAGGACGATACGCAGAACGCGCGCGCGATGCCGGATGC
GACGACCTATGCGGCATCGGACGATCCGTTCGCGGGCCTGTTCGATGCGTGCGCCGCGCCTTCGGTGGTG
CACGCTTCGACGCTCGCGCCGCCCGACGCCGACGTGGTGTGCGGCGGCTTCGAGCTAGGTCTCGACGATC
CGGCTTCGAAGCGCACCATCGACGAGCTTTTCGATCTCGCGCCGGGCGCGCATCTGTCGACGGATGCGCC
GATGGACGCGCTCGTCGAACCGCTGACGCAGCCCAACACCGCCCACGCCGACGATCCGTTCGCCAGCCTG
ACGGGCGCCCAACCTGCCGCGCCGCGCGCGACGCTCTCCGACGCGGGGCCGGAATTGCGCAGCGCGTTCA
CGCCGCCGAGACCGCGCGCCGCGCCGACGCCGACGCCCGCGCTCACGCCAGCCGAAACGCAGACCGGCGA
TAACGCGCTCATCGACGCCTTTCTGCAAGGCCTGAGCGCACCCGGCGTGCGGCTCGACGCGCTCACGCCC
GAGCTCATGCGGCTCATCGGCGAGCTATTGCACGAAGCGACGCAAGGCACGCTCGATCTGCTCGCCGCAC
GCGCCGCGTTCAAGCGCGAAATGCGCACGGACGCGACGATCATCGCGGCGGCGGACAACAATCCGCTCAA
GTTCTCGCCGAACGTGGAGGCCGCGCTCGCGCATCTGTTCGGCCCGCCGGTGCGCGGCTTTATGCCGCCC
GCCGCCGCGCTCGCCGATGCACACGCCGACTTGCGCGCGCATCAGGTTGGCATGGTCGCCGGCATGCGCG
CGGCGCTCGACGGCGTGTTCGAGCGTTTCGAGCCCAAGCGCATCGAGGCGCGCCTGTCGGGCCACTCGAT
GCTCGACGGCCTCTTACCCGGCATCAACCGGCGCGCGCGCTGCTGGGATCGCTTCATGGAGACTTACGGC
CAGCTCTCGAACGAGGCGACCGAAGATTTTCATGTGCTGTTCGGCCGCGCGTTCGTCGCCGCCTACGAGG
CGCAGATCAACGAACTGAAGCGCCGCGGCCGCCCATGA
 Primer design