SecReT6
Protein ID: 377810750
SecReT6 ID527
T6SS typei3
Gene symbolclpV
Locus tagBYI23_D001570
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]191216..193864 [-]
Producttype VI secretion ATPase, ClpV
NoteTssH
UniProt IDG8MKX5
KEGG IDbyi:BYI23_D001570
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.10E-37, Aligned region: 229..309
AAA_2 [PF07724], Evalue: 2.10E-37, Aligned region: 614..779
AAA [PF00004], Evalue: 6.90E-20, Aligned region: 229..362
AAA [PF00004], Evalue: 6.90E-20, Aligned region: 620..704
ClpB_D2-small [PF10431], Evalue: 7.40E-14, Aligned region: 787..860
AAA_5 [PF07728], Evalue: 2.50E-12, Aligned region: 229..307
AAA_5 [PF07728], Evalue: 2.50E-12, Aligned region: 619..734
AAA_16 [PF13191], Evalue: 7.70E-12, Aligned region: 52..76
AAA_16 [PF13191], Evalue: 7.70E-12, Aligned region: 126..178
AAA_16 [PF13191], Evalue: 7.70E-12, Aligned region: 206..251
AAA_16 [PF13191], Evalue: 7.70E-12, Aligned region: 273..307
AAA_16 [PF13191], Evalue: 7.70E-12, Aligned region: 517..517
AAA_16 [PF13191], Evalue: 7.70E-12, Aligned region: 611..664
AAA_22 [PF13401], Evalue: 1.50E-07, Aligned region: 63..98
AAA_22 [PF13401], Evalue: 1.50E-07, Aligned region: 229..309
AAA_22 [PF13401], Evalue: 1.50E-07, Aligned region: 617..653
Sigma54_activat [PF00158], Evalue: 4.80E-07, Aligned region: 136..160
Sigma54_activat [PF00158], Evalue: 4.80E-07, Aligned region: 213..255
Sigma54_activat [PF00158], Evalue: 4.80E-07, Aligned region: 618..732
AAA_14 [PF13173], Evalue: 9.20E-07, Aligned region: 229..326
AAA_14 [PF13173], Evalue: 9.20E-07, Aligned region: 618..736
AAA_19 [PF13245], Evalue: 3.30E-05, Aligned region: 228..252
AAA_19 [PF13245], Evalue: 3.30E-05, Aligned region: 375..406
AAA_19 [PF13245], Evalue: 3.30E-05, Aligned region: 617..641
Arch_ATPase [PF01637], Evalue: 3.70E-05, Aligned region: 208..249
Arch_ATPase [PF01637], Evalue: 3.70E-05, Aligned region: 280..312
Arch_ATPase [PF01637], Evalue: 3.70E-05, Aligned region: 619..654
Zeta_toxin [PF06414], Evalue: 4.90E-05, Aligned region: 229..249
Zeta_toxin [PF06414], Evalue: 4.90E-05, Aligned region: 613..659
Clp_N [PF02861], Evalue: 5.80E-05, Aligned region: 28..75
Clp_N [PF02861], Evalue: 5.80E-05, Aligned region: 110..131
AAA_17 [PF13207], Evalue: 7.00E-05, Aligned region: 229..255
AAA_17 [PF13207], Evalue: 7.00E-05, Aligned region: 495..527
AAA_17 [PF13207], Evalue: 7.00E-05, Aligned region: 619..655
IstB_IS21 [PF01695], Evalue: 8.50E-05, Aligned region: 211..253
IstB_IS21 [PF01695], Evalue: 8.50E-05, Aligned region: 619..644
AAA_18 [PF13238], Evalue: 0.00015, Aligned region: 229..252
AAA_18 [PF13238], Evalue: 0.00015, Aligned region: 621..647
AAA_25 [PF13481], Evalue: 0.00022, Aligned region: 224..306
AAA_25 [PF13481], Evalue: 0.00022, Aligned region: 617..641
AAA_29 [PF13555], Evalue: 0.00068, Aligned region: 221..246
AAA_29 [PF13555], Evalue: 0.00068, Aligned region: 617..644
NACHT [PF05729], Evalue: 0.00073, Aligned region: 229..257
NACHT [PF05729], Evalue: 0.00073, Aligned region: 620..651
Hpr_kinase_C [PF07475], Evalue: 0.0058, Aligned region: 229..241
Hpr_kinase_C [PF07475], Evalue: 0.0058, Aligned region: 617..637
DUF815 [PF05673], Evalue: 0.0072, Aligned region: 220..305
DUF815 [PF05673], Evalue: 0.0072, Aligned region: 619..660
NTPase_1 [PF03266], Evalue: 0.0078, Aligned region: 229..251
NTPase_1 [PF03266], Evalue: 0.0078, Aligned region: 281..306
NTPase_1 [PF03266], Evalue: 0.0078, Aligned region: 619..642
SRP54 [PF00448], Evalue: 0.0081, Aligned region: 228..252
SRP54 [PF00448], Evalue: 0.0081, Aligned region: 618..655
TIP49 [PF06068], Evalue: 0.0092, Aligned region: 229..250
TIP49 [PF06068], Evalue: 0.0092, Aligned region: 278..308
TIP49 [PF06068], Evalue: 0.0092, Aligned region: 618..655
UPF0079 [PF02367], Evalue: 0.0098, Aligned region: 229..249
UPF0079 [PF02367], Evalue: 0.0098, Aligned region: 617..647
Protein Sequence: 882 a.a.     [Download]
>gi|377810750|ref|YP_005043190.1| type VI secretion ATPase, ClpV [Burkholderia sp. YI23]
MAEINRVALFGKLDRLGYKTVESATIYCKMRGNPYVELAHWLMQILETPRSDLQRIVAHYRVDAAALARE
LTASLDRLPRGATSISDISEHITDAIERGWVYGTLLYGANKVRTGHLLVGMLKTPRLRHVLVGISRQFER
IGTEDLSDNFARIVADSAEEGEDEALAPPSASSGDAAPASMGRQEALHKYASDLTDRARQGALDPVTGRD
EEIRQLIDILMRRRQNNPLLTGEAGVGKTAVVEGFAQRLVRGDVPPSLREVALWSLDLGLLQAGASMKGE
FEQRLRQVVEDVQASPKPVILFIDEVHTIVGAGGTAGTGDAANLLKPALARGDLRTIGATTWSEYKKHIE
KDPALTRRFQVVQVHEPDEAKAVRMLRGVAAVLEGHHRVQLLDEAIEAAVRLSHRYIPARQLPDKAVSLL
DTACARVAVSQHATPPQVEDCQRRIESLDVEAQIVAREANVGVDVGTRAAEVESSLARERDALGGLEARW
AEEKRVVDELLALRASLREQGEAVDAPPPSRDERLARLAELKARLADLQGDAPLILPSVDAGVVAGVVAD
WTGIPVGRMLKNELAAVLNLADALDRRVIGQRHALEMIAKRIQTSRARLDNPDKPIGVFMLAGTSGVGKT
ETALALAETLYGGEQNVITINMSEFQEAHTVSTLKGAPPGYVGYGEGGILTEAVRRRPYSVVLLDEVEKA
HPDVHEIFFQVFDKGWMEDGEGRYIDFKNTIILLTSNVGSDLIMSMCRDPAGLPAPERLAAALRRPLLDV
FPAALLGRLVTVPYYPLSDAMMADIVRLQLERIRRRVAENHGIPFDYDDDAVRLIVSRCTEAESGGRVID
ALLTNTVLPRISTEYLTRLTEGGALERIRLSASANDFVYAFD
 
Nucleotide Sequence: 2649 bp     [Download]
>gi|377810593|ref|NC_016626.1|:c193864-191216 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
ATGGCGGAAATCAATCGGGTGGCGCTGTTCGGCAAGCTGGACAGGCTCGGCTACAAAACCGTCGAAAGCG
CGACGATCTACTGCAAAATGCGCGGCAATCCCTACGTGGAGCTCGCGCACTGGCTGATGCAGATACTGGA
GACGCCGCGCTCCGACCTGCAGCGCATCGTCGCGCACTATCGCGTGGACGCCGCCGCGCTCGCCCGCGAG
CTGACCGCCTCGCTCGATCGCCTGCCGCGCGGCGCGACGTCGATTTCCGATATCTCCGAGCACATCACCG
ACGCCATCGAACGCGGCTGGGTGTACGGCACCCTGCTCTACGGCGCGAACAAGGTGCGCACCGGCCATCT
GCTCGTCGGGATGCTCAAGACGCCGCGCCTGCGTCATGTGCTCGTCGGCATCTCGCGACAGTTCGAGCGC
ATCGGGACGGAAGATCTTTCGGACAACTTCGCGCGCATCGTCGCGGATTCGGCCGAAGAAGGCGAGGACG
AAGCGCTTGCGCCGCCATCCGCATCCAGCGGCGACGCCGCGCCGGCCAGCATGGGCAGGCAGGAAGCCTT
GCACAAGTACGCCAGCGATCTCACCGACCGCGCGCGTCAGGGCGCGCTCGATCCAGTCACGGGCCGCGAC
GAGGAGATTCGCCAGCTTATCGATATCCTGATGCGGCGGCGGCAGAACAATCCGCTTCTCACTGGCGAAG
CGGGCGTCGGCAAGACCGCGGTGGTCGAAGGTTTCGCGCAGCGCCTCGTGCGCGGCGATGTGCCGCCGTC
CTTGCGAGAGGTTGCGCTGTGGTCGCTGGACCTCGGTCTGCTGCAGGCGGGCGCGAGCATGAAGGGCGAA
TTCGAGCAGCGCCTGCGTCAGGTCGTCGAAGACGTGCAGGCAAGCCCGAAGCCGGTGATTCTTTTCATCG
ACGAAGTGCATACGATCGTCGGCGCGGGCGGCACGGCCGGCACCGGCGACGCGGCCAATCTGCTCAAGCC
AGCGCTCGCGCGCGGCGACTTGCGCACCATCGGCGCGACGACGTGGTCGGAGTACAAGAAGCACATCGAG
AAAGACCCCGCGCTCACGCGGCGCTTTCAGGTCGTGCAGGTTCACGAACCCGACGAGGCGAAGGCCGTGC
GCATGTTGCGCGGCGTGGCGGCCGTGCTCGAAGGCCATCACCGCGTGCAACTGCTCGACGAAGCGATCGA
AGCGGCCGTGCGGCTCTCGCATCGCTACATTCCCGCGCGTCAGTTGCCCGACAAGGCCGTTTCGCTGCTC
GACACCGCCTGCGCGCGCGTCGCGGTCAGCCAGCATGCGACGCCGCCGCAGGTCGAGGACTGTCAGCGCC
GCATCGAGTCGCTCGACGTGGAAGCGCAGATCGTCGCGCGCGAAGCGAATGTCGGTGTGGATGTCGGCAC
GCGCGCCGCGGAGGTCGAATCGTCGCTCGCCCGCGAACGCGATGCGCTCGGCGGGCTCGAAGCGCGCTGG
GCCGAGGAAAAGCGCGTGGTCGACGAACTGCTCGCGCTGCGGGCCTCGTTGCGCGAGCAAGGCGAAGCGG
TCGATGCGCCGCCGCCCTCGCGCGACGAGCGCCTCGCGCGCCTCGCGGAACTGAAGGCGCGTCTCGCCGA
CCTGCAAGGCGACGCGCCGCTGATCCTGCCGAGCGTCGATGCGGGCGTCGTCGCGGGCGTGGTCGCGGAC
TGGACCGGCATTCCCGTCGGCAGGATGCTCAAGAACGAACTCGCTGCCGTGCTCAATCTCGCCGATGCGC
TCGATCGCCGCGTGATCGGCCAGCGCCACGCGCTCGAGATGATCGCGAAGCGCATCCAGACGTCGCGCGC
GCGCCTCGACAATCCCGACAAGCCCATCGGCGTGTTCATGCTCGCCGGCACGTCGGGCGTCGGCAAGACG
GAAACCGCGCTCGCGCTCGCCGAAACGCTCTATGGCGGCGAGCAGAACGTCATCACCATCAACATGAGCG
AGTTCCAGGAAGCGCATACCGTCTCGACGCTCAAGGGCGCGCCGCCTGGCTACGTGGGCTACGGCGAAGG
CGGCATTCTCACGGAGGCGGTGCGCCGCCGTCCGTACAGCGTCGTGCTGCTCGACGAAGTGGAGAAGGCG
CATCCGGACGTGCACGAAATCTTCTTCCAGGTCTTCGACAAGGGCTGGATGGAGGACGGCGAAGGACGCT
ACATCGACTTCAAGAACACGATCATCCTGCTGACCTCGAACGTCGGCTCGGATCTCATCATGTCGATGTG
CCGCGATCCCGCCGGCCTGCCCGCGCCCGAGCGGCTCGCCGCCGCCCTGCGCCGGCCGCTCCTCGACGTG
TTTCCCGCCGCACTGCTCGGCAGGCTCGTCACGGTGCCCTACTACCCGCTCTCCGACGCGATGATGGCCG
ACATCGTGCGTTTGCAACTGGAGCGCATCCGCAGGCGCGTCGCGGAGAATCACGGCATTCCGTTCGATTA
CGACGACGACGCCGTGCGGCTCATCGTGTCGCGCTGCACGGAGGCCGAATCGGGCGGACGCGTGATCGAT
GCGCTGCTCACCAACACAGTGCTGCCGCGCATTTCCACGGAGTATCTGACGCGGCTCACCGAAGGCGGCG
CGCTCGAACGCATCCGGCTATCGGCGAGCGCGAACGACTTCGTCTATGCGTTCGACTGA
 Primer design