SecReT6
Protein ID: 377810751
SecReT6 ID527
T6SS typei3
Gene symbolsciB
Locus tagBYI23_D001580
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]196521..197576 [-]
Productputative cytoplasmic protein, sciB
NoteTssG
UniProt IDG8MKX6
KEGG IDbyi:BYI23_D001580
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.90E-100, Aligned region: 20..331
Protein Sequence: 351 a.a.     [Download]
>gi|377810751|ref|YP_005043191.1| putative cytoplasmic protein, sciB [Burkholderia sp. YI23]
MATPAATTRALVDLFETVAAEPHRFDFYQLMRRVEALTPDLPRLGASPRPADEAVRLAQDVSLAFAPAPL
AALAHADGGGAPRLTQRFFGFLGPNGPLPLHLTDFARERALHHGDTAFARLLDTLLHRFLLLFYRAWAQG
RPVTGLDRPDRDRFAFYTGALIGSADPASRARDAVSDHARLHFAGLMNMQTRPAEVIESIASALLRAPVR
VEPFRGHWMTLPREERTALRAGATRFSSQAAGFAQLGRGAVLGARTWDRQHAFRLVIGPLTLAQYEAFLP
GGAALPVLAALVRRHLNGELAWDAQLVLLAGEVPTAQPGRYGRLGYSAWIGRREHRADRADLALDADAHC
P
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|377810593|ref|NC_016626.1|:c197576-196521 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
ATCGCGACGCCGGCCGCTACCACGCGCGCGCTCGTCGATCTGTTCGAGACCGTCGCCGCCGAACCGCATC
GCTTCGATTTCTATCAGTTGATGCGGCGCGTCGAGGCGCTCACGCCGGACCTGCCGCGTCTCGGCGCAAG
CCCGCGTCCCGCCGACGAAGCCGTGCGCCTCGCCCAGGACGTCTCGCTCGCGTTCGCGCCCGCGCCGCTC
GCCGCGCTCGCGCACGCGGACGGCGGCGGCGCGCCGCGTCTCACCCAGCGCTTCTTCGGCTTTCTCGGTC
CGAACGGCCCGCTGCCGCTGCACCTGACCGATTTTGCCCGCGAGCGCGCGCTGCATCACGGCGACACGGC
CTTCGCGCGGCTGCTCGATACGCTGCTGCATCGCTTCCTGCTGCTGTTCTATCGCGCGTGGGCGCAAGGG
CGGCCCGTGACCGGGCTGGACCGGCCGGACCGCGACCGCTTCGCGTTCTATACCGGCGCGCTGATCGGTT
CCGCCGATCCGGCGAGCCGCGCGCGCGATGCCGTTTCCGATCATGCGCGGCTGCACTTCGCGGGCCTCAT
GAACATGCAGACGCGCCCTGCCGAAGTGATCGAGAGCATCGCGTCGGCGCTGTTGCGCGCGCCGGTGCGC
GTCGAGCCGTTTCGCGGCCACTGGATGACGCTGCCGCGCGAGGAGCGCACGGCGTTGCGCGCGGGCGCGA
CGCGCTTTTCCTCGCAGGCGGCGGGCTTCGCGCAGCTCGGCCGGGGCGCAGTGCTCGGCGCGCGCACGTG
GGACCGACAGCATGCGTTCCGGCTCGTGATCGGCCCGCTGACCCTCGCGCAGTACGAAGCGTTTCTGCCC
GGCGGCGCGGCGCTGCCGGTGCTCGCCGCGCTGGTTCGCCGGCATCTGAACGGCGAGCTTGCCTGGGACG
CGCAGCTCGTGCTCCTCGCTGGCGAAGTGCCGACGGCGCAGCCCGGCCGTTACGGGCGGCTCGGCTACTC
GGCGTGGATCGGCCGGCGTGAACATCGCGCCGATCGCGCCGATCTCGCGCTCGACGCCGATGCGCATTGC
CCGTGA
 Primer design