SecReT6
Protein ID: 377810752
SecReT6 ID527
T6SS typei3
Gene symbolsciC
Locus tagBYI23_D001590
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]197609..199492 [-]
Productputative cytoplasmic protein, sciC
NoteTssF
UniProt IDG8MKX7
KEGG IDbyi:BYI23_D001590
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.50E-193, Aligned region: 5..626
Protein Sequence: 627 a.a.     [Download]
>gi|377810752|ref|YP_005043192.1| putative cytoplasmic protein, sciC [Burkholderia sp. YI23]
MDPRLLRHYNTELAHLREMGAEFAQQFPKIAARLGMKGIDVADPYVERLLEGTAFLAARVQLKLEEEFPR
FTQQLAHVVLPQAGCPTPAMLIARLAPDLANPNLADGFTVPRHTALLSTRAPADTTPCEFRTAAALTLWP
VELTDARYLAQLPDLPLAALPATRPLAHRVKGAVRIRLATPEGLSFDALRLDALSLYFAGGDDTAYRLAE
RVLGGTLAIVVSTPERPSRALAVLPGDAVSLPGFDADEALLPVTPNAFQGYRVLHEYFALPERFRFARIE
GIASVLRAFPVREIELTFLLAAGDPPLERIVTKDHVLLHCVPAVNLFPKQANPALVTDAAARFHVIPDRT
HPLDYEVHSVTGVTGYGASDDSEQAFHPFYADYLADRPGEAAYFTVEREPRLVPAARKKSGARTDYVGSE
MYVSIVDPRAAPYRGALRQLSFATLCSNRDLPLMLTPGGAGSDFSLDIAAPVAAVHCVSGPSRPAPATLD
GAQTWRLIDQLSLHYLSLCNGPREAAAALRALLMLHVAPHDGAGRGQVAGVVSVDAKPVVRRLPMPGPIA
FGRGLSIDVLVDELAFQGGSAWLFGCVLDRFFARYVSINSFVQTTLRTDARGEILRSRTRCGTRAIF
 
Nucleotide Sequence: 1884 bp     [Download]
>gi|377810593|ref|NC_016626.1|:c199492-197609 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
ATGGACCCGCGCCTGCTGCGTCACTACAACACCGAGCTTGCCCACCTGCGCGAGATGGGCGCGGAATTCG
CCCAGCAGTTTCCGAAGATCGCGGCGCGGCTCGGCATGAAGGGCATCGACGTGGCCGACCCCTATGTCGA
GCGGCTGCTCGAAGGCACGGCGTTCCTGGCCGCACGCGTTCAACTGAAGCTCGAAGAAGAGTTTCCGCGT
TTCACGCAGCAACTCGCGCACGTCGTGCTGCCGCAGGCCGGATGTCCGACGCCCGCGATGCTGATCGCGC
GTCTCGCGCCCGATCTCGCCAATCCGAATCTCGCCGATGGCTTCACCGTGCCGCGTCACACCGCGCTGCT
TTCCACGCGCGCGCCCGCCGACACGACACCGTGCGAATTCCGCACGGCCGCGGCGCTCACGCTCTGGCCC
GTCGAGCTCACCGACGCGCGCTATCTCGCGCAGCTTCCGGACCTGCCGCTCGCCGCGCTGCCCGCGACGC
GCCCGCTCGCGCATCGCGTGAAAGGCGCGGTGCGCATCAGGCTCGCGACGCCGGAGGGCCTCTCGTTCGA
CGCCTTGCGTCTCGATGCGCTCTCGCTCTACTTCGCGGGCGGCGACGACACCGCGTACCGGCTCGCCGAA
CGCGTGCTCGGCGGCACGCTCGCGATCGTCGTATCGACGCCCGAGCGCCCGAGCCGCGCGCTCGCCGTGC
TGCCCGGCGACGCCGTCTCGCTGCCGGGTTTCGACGCGGACGAAGCGCTCCTGCCGGTCACGCCGAACGC
GTTCCAGGGCTATCGCGTGCTGCACGAGTATTTCGCGCTGCCCGAGCGCTTTCGCTTCGCCCGCATCGAA
GGGATCGCGAGCGTGCTGCGCGCCTTTCCCGTGCGCGAAATCGAGCTTACGTTCCTGCTCGCGGCGGGTG
ACCCACCGCTTGAACGCATCGTCACGAAGGATCACGTGCTGCTGCACTGCGTGCCCGCCGTCAATCTCTT
CCCGAAGCAGGCGAACCCCGCGCTCGTCACCGACGCCGCCGCGCGCTTTCATGTGATTCCCGACCGCACG
CATCCGCTCGATTACGAAGTGCATTCGGTTACGGGCGTGACCGGCTACGGCGCGAGCGACGACAGCGAGC
AGGCGTTCCATCCGTTCTATGCGGACTATCTCGCGGACCGGCCCGGCGAGGCCGCGTACTTCACCGTCGA
GCGCGAGCCGCGCCTCGTGCCCGCCGCGCGGAAAAAGAGCGGCGCGCGCACCGACTACGTCGGCAGCGAA
ATGTATGTATCGATCGTCGATCCGCGCGCCGCGCCGTATCGCGGCGCCTTGCGGCAACTGTCGTTCGCCA
CGCTGTGCAGCAACCGCGATTTGCCGCTGATGCTTACGCCAGGCGGCGCGGGCAGCGACTTCTCGCTCGA
CATCGCCGCGCCCGTCGCCGCCGTGCACTGCGTGAGCGGCCCGTCGCGGCCCGCGCCCGCGACGCTCGAC
GGCGCGCAAACCTGGCGTCTCATCGATCAGCTATCGCTGCACTATCTGTCGCTGTGCAACGGCCCGCGCG
AGGCCGCGGCGGCGCTGCGCGCGCTCCTGATGCTGCATGTCGCGCCCCACGACGGCGCGGGCCGCGGCCA
GGTCGCGGGCGTCGTATCCGTCGATGCGAAGCCCGTCGTGCGACGTTTGCCGATGCCCGGCCCGATCGCC
TTCGGGCGCGGCCTGTCGATCGACGTGCTGGTCGACGAACTCGCGTTTCAGGGCGGCAGCGCCTGGCTTT
TCGGCTGCGTGCTCGATCGCTTTTTCGCGCGTTACGTGTCGATCAATTCGTTCGTGCAGACGACGCTGCG
CACCGACGCGCGCGGCGAAATCCTGCGCTCGCGCACGCGATGCGGCACGCGAGCGATTTTCTAG
 Primer design