SecReT6
Protein ID: 377810753
SecReT6 ID527
T6SS typei3
Gene symbol-
Locus tagBYI23_D001600
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]199504..199992 [-]
Producttype VI secretion system lysozyme
NoteTssE
UniProt IDG8MKX8
KEGG IDbyi:BYI23_D001600
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.20E-21, Aligned region: 30..140
Protein Sequence: 162 a.a.     [Download]
>gi|377810753|ref|YP_005043193.1| type VI secretion system lysozyme [Burkholderia sp. YI23]
MNEPSAADRLQPSLLDRLIDDDPAAERFMTHRSLRAAVLRDVSWLFNTTNLGGAIEEEHFPHAFASVLNY
GLPCLSGRFASTIDTVLLEQAIRQAIERFEPRIDPSTLEIEPVLDRSVLDMHNQIALVIRGLLWAQPVPL
EFALRTQIDLEEGGITVMELPR
 
Nucleotide Sequence: 489 bp     [Download]
>gi|377810593|ref|NC_016626.1|:c199992-199504 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
ATGAACGAACCCAGCGCCGCCGACCGGCTCCAGCCGTCGCTGCTCGATCGCCTGATCGACGACGATCCCG
CCGCCGAGCGCTTCATGACGCATCGCAGTCTGCGCGCCGCGGTGCTGCGCGACGTGTCGTGGCTTTTCAA
CACGACCAACCTCGGCGGCGCGATCGAGGAAGAACACTTCCCGCACGCGTTCGCCTCGGTGCTCAACTAC
GGCTTGCCGTGCCTGTCGGGACGCTTCGCATCGACCATCGACACGGTGTTGCTCGAACAGGCGATCCGTC
AGGCGATCGAGCGCTTCGAGCCGCGCATCGATCCTTCGACGCTGGAGATCGAACCCGTGCTCGACCGCTC
CGTGCTCGACATGCACAACCAGATCGCGCTCGTGATCCGCGGCCTGCTGTGGGCGCAGCCGGTGCCGCTC
GAATTCGCGCTGCGCACGCAGATCGATCTGGAAGAAGGCGGCATCACCGTGATGGAACTGCCGCGCTGA
 Primer design