SecReT6
Protein ID: 377810754
SecReT6 ID527
T6SS typei3
Gene symbol-
Locus tagBYI23_D001610
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]200020..200628 [-]
Producthypothetical protein
NoteTssD
UniProt IDG8MKX9
KEGG IDbyi:BYI23_D001610
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.70E-11, Aligned region: 50..176
Protein Sequence: 202 a.a.     [Download]
>gi|377810754|ref|YP_005043194.1| hypothetical protein BYI23_D001610 [Burkholderia sp. YI23]
MRTMPSPDSRDSRLHDALSIDTLHQFELLALAQSDDMLLQVVPKRSNTPVKGEAGKRGDWDTPMQIHGWR
WAQGYDAASHGAALNANDMRVTALGVIRTADSASPVIAKLCAQAELLALAHIRCFKSAGTDHGVQIEYLS
MKLEQAYIRNYQVFTSPRFNRPCEIFELSAQQLTMTCAPQTDAGSRGADVTFALDVSTRRVS
 
Nucleotide Sequence: 609 bp     [Download]
>gi|377810593|ref|NC_016626.1|:c200628-200020 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
ATGAGGACGATGCCCAGCCCCGATTCACGCGATTCACGCCTGCACGACGCGCTCTCGATCGACACGCTGC
ACCAGTTCGAGCTGCTCGCGCTCGCGCAGTCCGACGACATGCTGCTGCAGGTCGTGCCCAAGCGCAGCAA
CACGCCGGTGAAGGGCGAAGCCGGCAAGCGCGGCGACTGGGACACGCCGATGCAGATTCACGGCTGGCGC
TGGGCGCAAGGCTACGACGCGGCCTCGCACGGGGCCGCGCTCAATGCGAACGACATGCGCGTGACGGCAC
TCGGCGTGATCAGGACAGCGGACTCGGCGTCGCCCGTCATCGCGAAACTGTGCGCGCAGGCGGAACTGCT
CGCGCTCGCGCATATCCGCTGCTTCAAGTCGGCGGGCACGGATCATGGCGTGCAGATCGAATATCTGTCG
ATGAAGCTCGAACAGGCGTATATCCGCAACTATCAGGTCTTCACAAGCCCGCGCTTCAATCGCCCGTGCG
AGATTTTCGAACTGTCCGCGCAGCAGCTTACGATGACCTGCGCGCCGCAAACCGACGCCGGCAGTAGAGG
CGCGGACGTGACTTTCGCGCTCGACGTGTCCACGCGGCGCGTGAGCTAG
 Primer design