SecReT6
Protein ID: 377810755
SecReT6 ID527
T6SS typei3
Gene symbol-
Locus tagBYI23_D001620
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]200771..201253 [+]
Producthypothetical protein
NoteTssD
UniProt IDG8MKY0
KEGG IDbyi:BYI23_D001620
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.40E-34, Aligned region: 7..136
Protein Sequence: 160 a.a.     [Download]
>gi|377810755|ref|YP_005043195.1| hypothetical protein BYI23_D001620 [Burkholderia sp. YI23]
MATIDCYLKVDGIEGESKHKGAEGQIEVQTFDWDATNSGSASVGGGSGQGKAHPGLFTFSHFYDKASPTL
EKSCVSGKHLASAKLTVSKAGEGQKEFLTVTMKQVTVTHVAVGGGMGGELRETVSLMYADIEFEYKPQDD
KGALGGAVKFGWDVRTTEVR
 
Nucleotide Sequence: 483 bp     [Download]
>gi|377810593|ref|NC_016626.1|:200771-201253 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
ATGGCAACGATCGACTGCTATCTCAAGGTTGATGGAATCGAAGGCGAATCGAAGCACAAGGGTGCGGAAG
GACAGATCGAGGTGCAGACCTTCGACTGGGACGCGACCAACTCCGGCAGCGCGTCCGTCGGCGGCGGCAG
CGGCCAGGGCAAGGCGCATCCCGGCCTGTTCACGTTCTCGCATTTCTACGACAAGGCCTCGCCCACGCTC
GAAAAAAGCTGCGTGAGCGGCAAGCACCTCGCGAGCGCCAAGCTCACCGTGAGCAAGGCGGGCGAAGGTC
AGAAAGAGTTCCTCACGGTGACGATGAAGCAGGTCACGGTGACGCACGTCGCGGTGGGCGGCGGCATGGG
CGGCGAGTTGCGGGAGACCGTGAGCCTGATGTACGCGGACATCGAATTCGAATACAAGCCGCAGGACGAC
AAGGGCGCGCTCGGCGGCGCGGTCAAGTTCGGCTGGGACGTGCGCACGACCGAAGTGCGCTGA
 Primer design