SecReT6
Protein ID: 377810756
SecReT6 ID527
T6SS typei3
Gene symbol-
Locus tagBYI23_D001630
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]201274..203655 [+]
Producthypothetical protein
NoteTssI
UniProt IDG8MKY1
KEGG IDbyi:BYI23_D001630
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.30E-65, Aligned region: 38..348
Phage_GPD [PF05954], Evalue: 1.30E-65, Aligned region: 637..664
Phage_base_V [PF04717], Evalue: 4.20E-27, Aligned region: 389..482
Gp5_C [PF06715], Evalue: 8.10E-17, Aligned region: 534..555
Gp5_C [PF06715], Evalue: 8.10E-17, Aligned region: 557..580
Gp5_C [PF06715], Evalue: 8.10E-17, Aligned region: 582..603
Gp5_C [PF06715], Evalue: 8.10E-17, Aligned region: 607..628
Gp5_C [PF06715], Evalue: 8.10E-17, Aligned region: 647..668
Gp5_C [PF06715], Evalue: 8.10E-17, Aligned region: 654..676
Gp5_C [PF06715], Evalue: 8.10E-17, Aligned region: 664..683
Gp5_C [PF06715], Evalue: 8.10E-17, Aligned region: 678..699
Gp5_C [PF06715], Evalue: 8.10E-17, Aligned region: 685..708
Gp5_C [PF06715], Evalue: 8.10E-17, Aligned region: 702..723
Gp5_C [PF06715], Evalue: 8.10E-17, Aligned region: 757..769
Protein Sequence: 793 a.a.     [Download]
>gi|377810756|ref|YP_005043196.1| hypothetical protein BYI23_D001630 [Burkholderia sp. YI23]
MASNDAVTAQPLASVDTPLADDLRFLSLRASAALGRMPCCELTLVSKRADIDIARILGKRVSVSLHLEGA
KPRVFGGYVVSFRQTGMRGRLFMYEAAVRPWLWLLTRRSNCRIFQNKTVEEIVKAIFADPVYKQLEIGEV
KWKANARTHPPREYCVQYRESDFNFVSRLLEDEGIYYWFQDTDGKEALILTDTPAAHDSVAGCESLPYGA
VMNAAPAIDYVSEWRVNHMIETRNWLLTDYDFKHPSRALQKQAVKQMPGFDAFSGLEHFDYPGGYADANH
GESRAKTRADEWLVEGGASADRDINWHQADARTNSKRVRTGALLKLTRHPRADQNTQYLVTRTQYEIDLA
DYEAFDGAQSNRCECWFSAIDAKQPFAPARVTRKPFVQGPQTAVVVGPGGDEIHTDPYGRVKVQFFWDRQ
GKRDENSSCWIRVSQPWAGKGFGAIAIPRMGQEVIVDFLEGDPDRPIITGRVYNAEQMPPYDLPANMTQS
GIKSRSSKGGSAANCNEFRFEDKKGAEQVLLHAERNQDIEVEKDETHWVGNDRKKNIDHDETTVVKHNRT
ETVGNDEKIDVVMNRTETVGVDERITIGSNRTKTVKASETATVFLQRTHSVGINETITVGAAQEVTVGAF
QAVTVGAYQIVTIGAYHTETVGASQTVSVGSSQTVSVGSDQTVSVGGKQSTSVGGDQSLAVSGAQTVTVA
KDASESIDGAQSSTVGKGRTTSVTEDDALKVGKNLIIEAAESVVIKTGDASILMKKDGTIQIKGKNVSIV
ASGKINAKADSEIAMTGSKILQN
 
Nucleotide Sequence: 2382 bp     [Download]
>gi|377810593|ref|NC_016626.1|:201274-203655 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
ATGGCCAGCAACGATGCCGTAACGGCGCAACCGCTCGCAAGCGTCGATACGCCGCTCGCCGACGACCTGC
GCTTTCTGTCGCTGCGTGCGAGCGCGGCGCTCGGGCGCATGCCGTGCTGCGAGCTCACGCTCGTGTCGAA
GCGCGCGGATATCGACATCGCGCGGATACTCGGCAAGCGCGTGAGCGTGTCGCTGCACCTGGAAGGCGCA
AAGCCGCGCGTGTTCGGCGGCTATGTGGTGAGCTTCCGGCAGACCGGCATGCGCGGGCGCCTCTTCATGT
ACGAAGCGGCGGTGCGCCCGTGGCTGTGGCTGCTCACGCGGCGCAGCAACTGCCGCATCTTCCAGAACAA
GACGGTCGAGGAGATCGTGAAGGCGATCTTCGCCGATCCAGTCTACAAGCAGCTCGAAATCGGCGAAGTC
AAGTGGAAGGCCAACGCGCGCACGCATCCGCCGCGTGAATACTGCGTGCAGTATCGGGAGTCGGATTTCA
ACTTCGTCAGCCGTCTGCTGGAAGACGAGGGCATCTACTACTGGTTTCAGGACACGGACGGCAAGGAAGC
GCTCATCCTGACCGACACGCCCGCCGCGCACGACAGCGTCGCGGGCTGCGAATCGCTGCCGTACGGCGCG
GTGATGAATGCCGCGCCCGCCATCGATTATGTGAGCGAGTGGCGCGTCAATCACATGATCGAAACGCGCA
ACTGGCTGCTCACCGACTACGACTTCAAGCATCCGTCGCGCGCCTTGCAGAAACAGGCCGTCAAGCAGAT
GCCGGGCTTCGACGCGTTTTCCGGGCTGGAGCATTTCGATTACCCCGGCGGCTATGCCGATGCGAATCAC
GGCGAAAGCCGGGCGAAAACGCGTGCGGACGAATGGCTCGTCGAAGGCGGCGCGAGCGCGGACCGCGACA
TCAACTGGCATCAGGCCGACGCGCGCACCAACAGCAAGCGCGTGCGCACGGGTGCATTGCTCAAGCTGAC
GCGCCATCCGCGCGCCGATCAGAACACGCAATATCTCGTCACGCGCACGCAATACGAGATCGATCTGGCC
GATTACGAAGCCTTCGACGGCGCGCAGTCGAACCGCTGCGAGTGCTGGTTCTCCGCGATCGACGCGAAGC
AGCCCTTCGCGCCCGCACGCGTGACGCGCAAGCCGTTCGTTCAGGGGCCGCAGACGGCGGTGGTCGTCGG
GCCCGGCGGCGACGAAATCCATACGGACCCGTATGGCCGGGTCAAGGTGCAGTTCTTCTGGGACCGGCAA
GGCAAGCGCGACGAGAACAGTTCGTGCTGGATACGCGTGTCGCAGCCGTGGGCGGGCAAGGGCTTCGGGG
CGATCGCGATTCCGCGCATGGGGCAGGAAGTGATCGTCGATTTTCTGGAAGGCGATCCGGACCGGCCGAT
CATCACCGGGCGCGTCTACAACGCCGAACAGATGCCGCCTTACGACCTGCCCGCGAACATGACGCAGTCC
GGCATCAAAAGCCGCTCGTCGAAGGGCGGCAGCGCGGCGAACTGCAACGAATTCCGCTTCGAAGACAAGA
AGGGCGCCGAGCAGGTGCTGCTGCATGCCGAGCGCAATCAGGATATCGAAGTGGAGAAGGACGAGACGCA
TTGGGTCGGCAACGACCGCAAGAAGAACATCGACCACGACGAGACCACGGTCGTGAAGCACAACCGCACG
GAAACGGTCGGCAACGACGAGAAGATCGACGTCGTGATGAATCGCACCGAGACGGTGGGCGTCGACGAGC
GCATCACGATCGGCTCGAACCGGACCAAGACCGTGAAGGCGAGCGAGACCGCGACGGTGTTTCTGCAGCG
CACGCACAGCGTGGGCATTAACGAGACCATCACGGTGGGTGCGGCGCAGGAGGTCACAGTCGGCGCGTTC
CAGGCCGTGACGGTCGGCGCGTATCAGATCGTGACGATTGGCGCTTATCACACGGAGACCGTCGGCGCGA
GTCAGACGGTGAGCGTCGGGTCCAGCCAGACCGTGTCGGTGGGCTCGGATCAGACGGTGAGCGTGGGCGG
CAAGCAGTCGACGAGCGTGGGCGGCGATCAGTCGCTCGCGGTGAGCGGCGCACAGACGGTGACGGTTGCC
AAGGACGCGAGCGAGTCGATCGACGGCGCGCAGTCGAGCACGGTGGGCAAGGGGCGCACGACCTCGGTGA
CAGAAGACGACGCGCTCAAGGTGGGCAAGAATCTCATCATCGAGGCGGCCGAGTCGGTGGTCATCAAGAC
GGGCGATGCGAGCATTCTCATGAAGAAGGATGGCACCATCCAGATCAAAGGGAAGAATGTGTCGATCGTC
GCGAGCGGGAAGATCAACGCGAAGGCGGACAGCGAAATCGCGATGACGGGTTCGAAGATTCTGCAGAATT
GA
 Primer design