SecReT6
Protein ID: 377810933
SecReT6 ID528
T6SS typeN/A
Gene symbol-
Locus tagBYI23_D003400
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]404868..407513 [+]
Producthypothetical protein
NoteTssI
UniProt IDG8MLX0
KEGG IDbyi:BYI23_D003400
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.90E-54, Aligned region: 30..346
Phage_GPD [PF05954], Evalue: 4.90E-54, Aligned region: 560..590
DUF2345 [PF10106], Evalue: 2.40E-43, Aligned region: 538..593
DUF2345 [PF10106], Evalue: 2.40E-43, Aligned region: 603..751
T6SS_Vgr [PF13296], Evalue: 1.80E-31, Aligned region: 481..585
Phage_base_V [PF04717], Evalue: 2.70E-09, Aligned region: 419..474
Sarcoglycan_1 [PF04790], Evalue: 0.0051, Aligned region: 532..565
Sarcoglycan_1 [PF04790], Evalue: 0.0051, Aligned region: 613..640
Sarcoglycan_1 [PF04790], Evalue: 0.0051, Aligned region: 671..733
Protein Sequence: 881 a.a.     [Download]
>gi|377810933|ref|YP_005043373.1| hypothetical protein BYI23_D003400 [Burkholderia sp. YI23]
MSMVVPSQAYTLLLKPQPAPLVVLNWSGTAAISQLYEYKIDFTSAADISMDEVVGRPATFGVEPVDPAAG
YLQQMFGEKWKDFSKLPQRYDTHGIIQQFEVLGTSADETRYRVTLVPKVADLARVRKSRLFQKQSAVEII
TDTLRNYGYRLGVDFDFLKLRGKYKRHEYITQYHETTFDFIRRLCAEEGLWFRFEQKHDRSVIIFGDDLD
AYARKQRIVPFRSHSGLESAGAESIRSLRTITQRVPEAIQLNDYNHRQADANLLVEANAAPADKTTDGID
NHWGEHYETLEEGREIARRRHEEHLATQISYRARGNPFSLEVGEVVVLDVNPKDAPHGLFVTSIRCGGGR
ARSYWCAFRAIPADRRWRTSITSVTRPKIEGILPARIDSPGKYTYSYLTEKGLYVTVMPFDLDEWSPGGR
SRAIRMMRPYAGANYGHHFPLIDGAEVALIFTAQDPNRPVIAGSLHDSLNPDLVNNLNNTRNLLRTAALN
EVRMEDKRGYEHIHLTTPYQTSELNLGHMVDGDRKERGRGAELRSDGHIAVRGGKGVFISADAQNAASGK
QLDMQPAQSLLEQALQQMEALAEAAKAAQAVAADYEKQKRFLDDTLTQLKKAGLLLSAPDGIALASGSDM
QLSTSENLIVTAGGSADIGVLKRFTVAAGEAISMFAQKLGMKLFAKGKVDVRSISDEMALAALKDVTITS
TAGRLILSAAREVWIGAGGSYIKINANRIENGTPGDILEKCAAWNKQGATSTQQQRQELFDSQVELKFSR
QFHVDSALRSFANSTGAMKYRILDETGVLIGGGALGESGQTLRAFTDTPKPIKAVFDLGDGKWSVLNYKE
SFEFSSDAPTGQHLGVFDYADHSTSDAQSHTDDETDENDVI
 
Nucleotide Sequence: 2646 bp     [Download]
>gi|377810593|ref|NC_016626.1|:404868-407513 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
ATGTCGATGGTGGTACCGTCTCAAGCCTATACATTGCTGCTCAAGCCACAACCCGCCCCGCTGGTCGTGT
TGAACTGGTCAGGTACAGCGGCTATCAGCCAGTTGTACGAATATAAGATCGACTTCACGAGCGCTGCCGA
CATTTCGATGGATGAGGTCGTGGGCAGACCCGCCACCTTCGGCGTGGAGCCAGTTGACCCGGCTGCAGGC
TATCTGCAACAAATGTTCGGCGAGAAGTGGAAAGACTTCAGCAAGTTGCCCCAGCGCTACGACACGCACG
GCATTATTCAGCAGTTTGAAGTTCTCGGGACATCGGCGGACGAGACCCGCTATCGCGTCACGCTCGTTCC
CAAAGTCGCGGATCTGGCAAGGGTCAGGAAGAGCAGACTCTTCCAGAAGCAAAGTGCCGTCGAAATTATT
ACGGACACCTTGAGGAATTACGGCTATCGCCTGGGTGTGGACTTCGACTTCCTCAAATTGCGAGGAAAGT
ACAAGCGGCACGAATATATCACTCAGTATCACGAAACGACGTTTGATTTTATTCGGAGACTCTGTGCGGA
AGAGGGCCTGTGGTTCAGGTTCGAACAGAAACACGATCGCTCGGTCATCATCTTTGGCGACGATCTGGAT
GCGTATGCGAGAAAGCAACGGATCGTTCCTTTCCGTTCCCACTCGGGCCTAGAGAGCGCGGGCGCCGAGT
CGATCCGATCGCTCAGGACGATCACGCAGCGCGTGCCGGAAGCGATTCAACTGAACGACTACAACCATCG
ACAGGCGGACGCGAACCTGCTGGTGGAGGCGAATGCCGCGCCGGCGGACAAGACCACCGACGGCATCGAT
AACCACTGGGGCGAACATTACGAAACGCTCGAAGAGGGCAGAGAGATCGCGCGGCGGCGTCACGAGGAGC
ATCTGGCTACGCAGATCAGCTATCGGGCGCGGGGCAATCCGTTCTCGCTCGAAGTGGGTGAGGTTGTCGT
TCTCGATGTGAACCCGAAGGATGCACCGCACGGGCTCTTCGTCACATCGATTCGCTGCGGCGGTGGCCGG
GCCAGGTCGTACTGGTGCGCGTTCCGGGCCATTCCGGCGGATCGCCGGTGGCGAACGAGCATCACATCGG
TTACACGACCCAAAATCGAAGGCATCCTGCCGGCGCGAATCGATTCGCCGGGAAAATACACGTATTCGTA
CCTGACCGAAAAAGGCTTGTACGTGACGGTGATGCCGTTCGATCTGGACGAGTGGAGTCCGGGCGGCAGG
AGTCGTGCAATCCGCATGATGAGGCCTTATGCGGGGGCGAACTACGGTCATCATTTTCCGCTGATCGACG
GGGCGGAAGTTGCGCTGATTTTCACTGCGCAAGATCCCAATCGACCGGTGATTGCCGGGTCACTTCACGA
CAGCCTCAACCCCGATCTCGTCAATAACCTCAATAACACGCGAAACCTGCTTCGCACCGCCGCGCTCAAC
GAGGTGCGCATGGAGGATAAGCGGGGTTATGAGCATATCCATCTGACTACGCCGTATCAGACCAGCGAGT
TGAATCTGGGGCATATGGTTGATGGGGATCGGAAGGAGCGGGGGCGTGGGGCGGAGTTGAGGAGCGATGG
GCACATAGCCGTTAGAGGGGGGAAGGGCGTATTTATCTCTGCGGACGCGCAGAACGCCGCAAGCGGAAAA
CAGCTCGACATGCAACCGGCTCAAAGCCTGCTCGAACAGGCGCTTCAGCAAATGGAAGCGCTTGCCGAGG
CCGCGAAGGCTGCACAAGCCGTCGCTGCGGACTATGAAAAGCAAAAGCGATTTCTCGACGATACGTTGAC
TCAACTAAAGAAGGCGGGTCTGCTGCTTAGCGCCCCCGACGGAATTGCGCTGGCGTCCGGATCGGACATG
CAGCTCAGCACGAGCGAAAACCTCATCGTGACCGCAGGTGGCAGTGCCGACATCGGCGTGCTTAAGCGTT
TCACCGTGGCGGCAGGCGAGGCCATCTCGATGTTCGCTCAAAAACTTGGAATGAAGCTTTTCGCGAAAGG
CAAAGTAGATGTCAGATCGATTAGCGACGAAATGGCCCTCGCAGCACTAAAGGACGTGACAATCACGAGT
ACCGCTGGACGCCTCATTTTGTCGGCGGCCAGGGAAGTCTGGATCGGTGCGGGTGGGTCGTACATCAAGA
TCAATGCTAATCGAATCGAGAACGGAACGCCAGGGGACATTCTCGAGAAATGCGCTGCATGGAATAAGCA
AGGTGCAACTAGCACGCAACAGCAACGTCAAGAACTTTTCGATAGTCAGGTCGAGCTCAAATTCAGTCGG
CAGTTCCATGTCGATTCTGCATTGCGTTCATTCGCCAATTCAACCGGCGCGATGAAATATCGAATTCTCG
ACGAAACGGGTGTCCTGATCGGCGGCGGAGCGCTTGGTGAAAGTGGCCAGACTTTGAGGGCATTCACGGA
CACGCCGAAGCCAATCAAGGCGGTATTCGATCTGGGTGATGGAAAGTGGAGCGTGCTGAATTACAAGGAA
TCGTTCGAATTTTCGAGTGACGCGCCGACGGGGCAACATTTGGGGGTGTTCGATTACGCAGATCATTCGA
CTTCAGATGCCCAGTCACATACAGATGACGAGACCGACGAAAACGATGTTATCTAA
 Primer design