SecReT6
Protein ID: 377810933
SecReT6 ID528
T6SS typeN/A
Gene symbol-
Locus tagBYI23_D003400
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]404868..407513 [+]
Producthypothetical protein
NoteTssI
UniProt IDG8MLX0
KEGG IDbyi:BYI23_D003400
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.90E-54, Aligned region: 30..346
Phage_GPD [PF05954], Evalue: 4.90E-54, Aligned region: 560..590
DUF2345 [PF10106], Evalue: 2.40E-43, Aligned region: 538..593
DUF2345 [PF10106], Evalue: 2.40E-43, Aligned region: 603..751
T6SS_Vgr [PF13296], Evalue: 1.80E-31, Aligned region: 481..585
Phage_base_V [PF04717], Evalue: 2.70E-09, Aligned region: 419..474
Sarcoglycan_1 [PF04790], Evalue: 0.0051, Aligned region: 532..565
Sarcoglycan_1 [PF04790], Evalue: 0.0051, Aligned region: 613..640
Sarcoglycan_1 [PF04790], Evalue: 0.0051, Aligned region: 671..733
Protein Sequence: 881 a.a.     [Download]
>gi|377810933|ref|YP_005043373.1| hypothetical protein BYI23_D003400 [Burkholderia sp. YI23]
MSMVVPSQAYTLLLKPQPAPLVVLNWSGTAAISQLYEYKIDFTSAADISMDEVVGRPATFGVEPVDPAAG
YLQQMFGEKWKDFSKLPQRYDTHGIIQQFEVLGTSADETRYRVTLVPKVADLARVRKSRLFQKQSAVEII
TDTLRNYGYRLGVDFDFLKLRGKYKRHEYITQYHETTFDFIRRLCAEEGLWFRFEQKHDRSVIIFGDDLD
AYARKQRIVPFRSHSGLESAGAESIRSLRTITQRVPEAIQLNDYNHRQADANLLVEANAAPADKTTDGID
NHWGEHYETLEEGREIARRRHEEHLATQISYRARGNPFSLEVGEVVVLDVNPKDAPHGLFVTSIRCGGGR
ARSYWCAFRAIPADRRWRTSITSVTRPKIEGILPARIDSPGKYTYSYLTEKGLYVTVMPFDLDEWSPGGR
SRAIRMMRPYAGANYGHHFPLIDGAEVALIFTAQDPNRPVIAGSLHDSLNPDLVNNLNNTRNLLRTAALN
EVRMEDKRGYEHIHLTTPYQTSELNLGHMVDGDRKERGRGAELRSDGHIAVRGGKGVFISADAQNAASGK
QLDMQPAQSLLEQALQQMEALAEAAKAAQAVAADYEKQKRFLDDTLTQLKKAGLLLSAPDGIALASGSDM
QLSTSENLIVTAGGSADIGVLKRFTVAAGEAISMFAQKLGMKLFAKGKVDVRSISDEMALAALKDVTITS
TAGRLILSAAREVWIGAGGSYIKINANRIENGTPGDILEKCAAWNKQGATSTQQQRQELFDSQVELKFSR
QFHVDSALRSFANSTGAMKYRILDETGVLIGGGALGESGQTLRAFTDTPKPIKAVFDLGDGKWSVLNYKE
SFEFSSDAPTGQHLGVFDYADHSTSDAQSHTDDETDENDVI
 
Nucleotide Sequence: 2646 bp     [Download]
>gi|377810593|ref|NC_016626.1|:404868-407513 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
ATGTCGATGGTGGTACCGTCTCAAGCCTATACATTGCTGCTCAAGCCACAACCCGCCCCGCTGGTCGTGT
TGAACTGGTCAGGTACAGCGGCTATCAGCCAGTTGTACGAATATAAGATCGACTTCACGAGCGCTGCCGA
CATTTCGATGGATGAGGTCGTGGGCAGACCCGCCACCTTCGGCGTGGAGCCAGTTGACCCGGCTGCAGGC
TATCTGCAACAAATGTTCGGCGAGAAGTGGAAAGACTTCAGCAAGTTGCCCCAGCGCTACGACACGCACG
GCATTATTCAGCAGTTTGAAGTTCTCGGGACATCGGCGGACGAGACCCGCTATCGCGTCACGCTCGTTCC
CAAAGTCGCGGATCTGGCAAGGGTCAGGAAGAGCAGACTCTTCCAGAAGCAAAGTGCCGTCGAAATTATT
ACGGACACCTTGAGGAATTACGGCTATCGCCTGGGTGTGGACTTCGACTTCCTCAAATTGCGAGGAAAGT
ACAAGCGGCACGAATATATCACTCAGTATCACGAAACGACGTTTGATTTTATTCGGAGACTCTGTGCGGA
AGAGGGCCTGTGGTTCAGGTTCGAACAGAAACACGATCGCTCGGTCATCATCTTTGGCGACGATCTGGAT
GCGTATGCGAGAAAGCAACGGATCGTTCCTTTCCGTTCCCACTCGGGCCTAGAGAGCGCGGGCGCCGAGT
CGATCCGATCGCTCAGGACGATCACGCAGCGCGTGCCGGAAGCGATTCAACTGAACGACTACAACCATCG
ACAGGCGGACGCGAACCTGCTGGTGGAGGCGAATGCCGCGCCGGCGGACAAGACCACCGACGGCATCGAT
AACCACTGGGGCGAACATTACGAAACGCTCGAAGAGGGCAGAGAGATCGCGCGGCGGCGTCACGAGGAGC
ATCTGGCTACGCAGATCAGCTATCGGGCGCGGGGCAATCCGTTCTCGCTCGAAGTGGGTGAGGTTGTCGT
TCTCGATGTGAACCCGAAGGATGCACCGCACGGGCTCTTCGTCACATCGATTCGCTGCGGCGGTGGCCGG
GCCAGGTCGTACTGGTGCGCGTTCCGGGCCATTCCGGCGGATCGCCGGTGGCGAACGAGCATCACATCGG
TTACACGACCCAAAATCGAAGGCATCCTGCCGGCGCGAATCGATTCGCCGGGAAAATACACGTATTCGTA
CCTGACCGAAAAAGGCTTGTACGTGACGGTGATGCCGTTCGATCTGGACGAGTGGAGTCCGGGCGGCAGG
AGTCGTGCAATCCGCATGATGAGGCCTTATGCGGGGGCGAACTACGGTCATCATTTTCCGCTGATCGACG
GGGCGGAAGTTGCGCTGATTTTCACTGCGCAAGATCCCAATCGACCGGTGATTGCCGGGTCACTTCACGA
CAGCCTCAACCCCGATCTCGTCAATAACCTCAATAACACGCGAAACCTGCTTCGCACCGCCGCGCTCAAC
GAGGTGCGCATGGAGGATAAGCGGGGTTATGAGCATATCCATCTGACTACGCCGTATCAGACCAGCGAGT
TGAATCTGGGGCATATGGTTGATGGGGATCGGAAGGAGCGGGGGCGTGGGGCGGAGTTGAGGAGCGATGG
GCACATAGCCGTTAGAGGGGGGAAGGGCGTATTTATCTCTGCGGACGCGCAGAACGCCGCAAGCGGAAAA
CAGCTCGACATGCAACCGGCTCAAAGCCTGCTCGAACAGGCGCTTCAGCAAATGGAAGCGCTTGCCGAGG
CCGCGAAGGCTGCACAAGCCGTCGCTGCGGACTATGAAAAGCAAAAGCGATTTCTCGACGATACGTTGAC
TCAACTAAAGAAGGCGGGTCTGCTGCTTAGCGCCCCCGACGGAATTGCGCTGGCGTCCGGATCGGACATG
CAGCTCAGCACGAGCGAAAACCTCATCGTGACCGCAGGTGGCAGTGCCGACATCGGCGTGCTTAAGCGTT
TCACCGTGGCGGCAGGCGAGGCCATCTCGATGTTCGCTCAAAAACTTGGAATGAAGCTTTTCGCGAAAGG
CAAAGTAGATGTCAGATCGATTAGCGACGAAATGGCCCTCGCAGCACTAAAGGACGTGACAATCACGAGT
ACCGCTGGACGCCTCATTTTGTCGGCGGCCAGGGAAGTCTGGATCGGTGCGGGTGGGTCGTACATCAAGA
TCAATGCTAATCGAATCGAGAACGGAACGCCAGGGGACATTCTCGAGAAATGCGCTGCATGGAATAAGCA
AGGTGCAACTAGCACGCAACAGCAACGTCAAGAACTTTTCGATAGTCAGGTCGAGCTCAAATTCAGTCGG
CAGTTCCATGTCGATTCTGCATTGCGTTCATTCGCCAATTCAACCGGCGCGATGAAATATCGAATTCTCG
ACGAAACGGGTGTCCTGATCGGCGGCGGAGCGCTTGGTGAAAGTGGCCAGACTTTGAGGGCATTCACGGA
CACGCCGAAGCCAATCAAGGCGGTATTCGATCTGGGTGATGGAAAGTGGAGCGTGCTGAATTACAAGGAA
TCGTTCGAATTTTCGAGTGACGCGCCGACGGGGCAACATTTGGGGGTGTTCGATTACGCAGATCATTCGA
CTTCAGATGCCCAGTCACATACAGATGACGAGACCGACGAAAACGATGTTATCTAA
 Primer design

Protein ID: 377810936
SecReT6 ID528
T6SS typeN/A
Gene symbol-
Locus tagBYI23_D003430
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]411970..412800 [+]
Producthypothetical protein
NoteTssI
UniProt IDG8MLX3
KEGG IDbyi:BYI23_D003430
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.70E-44, Aligned region: 30..265
Protein Sequence: 276 a.a.     [Download]
>gi|377810936|ref|YP_005043376.1| hypothetical protein BYI23_D003430 [Burkholderia sp. YI23]
MSMVLPSQAYSLVLKPQPAPISVLRWSCEAAISQLYKYTVEFTSAVDISKDEVVGRPATFSVEPEDPSAG
HLQQMFGERWKDFSKMPKRYDTHGIIQQFEVLGTSADETRYRVTLAPKIADLSRVRKSRLFQKQSVVEII
TDTLRHYGYRLGVDFDFLKLRGKYKRHEYITQYNESTFGFVQRLCAEEGLWFRFEQKHDRTIIVFGDDLD
AYARKQRIIPYRSHSGLESAGDESIRSLRTITQRVPEAIQLNDYNHRQADVNLLVEANAAPADKNP
 
Nucleotide Sequence: 831 bp     [Download]
>gi|377810593|ref|NC_016626.1|:411970-412800 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
ATGTCGATGGTGTTACCGAGTCAGGCATACAGCCTGGTCCTCAAACCACAACCCGCGCCCATATCCGTAT
TGCGCTGGTCGTGCGAAGCTGCTATCAGCCAGCTCTACAAGTACACGGTCGAGTTCACGAGCGCCGTGGA
TATCTCGAAGGATGAGGTTGTGGGACGGCCCGCGACATTCAGCGTCGAGCCCGAGGACCCCTCAGCAGGC
CATTTGCAGCAAATGTTCGGCGAGCGCTGGAAAGACTTCAGCAAGATGCCCAAACGCTATGACACGCATG
GGATCATCCAGCAATTCGAGGTACTCGGAACATCGGCCGATGAAACGCGGTATCGCGTCACGCTGGCGCC
GAAAATAGCTGATTTGTCAAGAGTTCGAAAAAGCAGACTATTCCAAAAGCAAAGCGTTGTCGAGATCATT
ACCGACACCCTGCGTCACTACGGCTATCGCTTGGGCGTGGACTTTGATTTCCTCAAGCTGCGCGGCAAGT
ACAAACGTCACGAATATATCACTCAGTATAACGAATCGACCTTCGGATTCGTACAACGGCTCTGTGCTGA
AGAGGGGTTGTGGTTCCGGTTCGAGCAAAAGCACGATCGAACGATCATCGTCTTTGGCGATGATCTGGAT
GCCTACGCCAGAAAGCAGCGGATCATTCCCTATCGCAGCCACTCGGGCCTCGAAAGCGCGGGTGACGAGT
CGATCCGCTCGCTCAGGACGATTACGCAGCGCGTGCCCGAAGCGATCCAGTTGAATGACTACAACCATCG
TCAGGCGGATGTGAACCTGCTGGTGGAGGCGAACGCTGCACCGGCGGATAAGAACCCTTAA
 Primer design

Protein ID: 377810938
SecReT6 ID528
T6SS typeN/A
Gene symbol-
Locus tagBYI23_D003450
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]413760..415541 [+]
Producthypothetical protein
NoteTssI
UniProt IDG8MLX5
KEGG IDbyi:BYI23_D003450
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 8.70E-46, Aligned region: 243..257
DUF2345 [PF10106], Evalue: 8.70E-46, Aligned region: 307..455
T6SS_Vgr [PF13296], Evalue: 2.60E-29, Aligned region: 185..290
T6SS_Vgr [PF13296], Evalue: 2.60E-29, Aligned region: 325..347
Phage_base_V [PF04717], Evalue: 1.20E-11, Aligned region: 103..179
Phage_base_V [PF04717], Evalue: 1.20E-11, Aligned region: 346..376
Sarcoglycan_1 [PF04790], Evalue: 0.0016, Aligned region: 237..259
Sarcoglycan_1 [PF04790], Evalue: 0.0016, Aligned region: 317..345
Sarcoglycan_1 [PF04790], Evalue: 0.0016, Aligned region: 376..421
Protein Sequence: 593 a.a.     [Download]
>gi|377810938|ref|YP_005043378.1| hypothetical protein BYI23_D003450 [Burkholderia sp. YI23]
MARRRHEEHLATQISYRGRGNPFSLEIGEVVGLDVNPMDAPHGLFVTSIRCGGGRAVSYWCAFRAIPADR
RWRTSIESVKRPKIEGVLPARIDSPGKYTYSYVTEKGLYVVKMPFDLDEWSPGGRSRAIRMMRPYAGANY
GHHFPLIDGAKVALIFTAQDPDRPVIAGSLHDSLNPDLVNNLNHTRNILRTAALNEMRMEDKRGFEHIHL
TTPFQTSELNLGHMVDGDRKERGRGAELRSDEHIALRGGKGVFISADTQNAAGGKQLDMQPAQALLEQAL
LQTQSLAEAAKAAQAIAADYENQKALLDGTLRELKNAAVVVSAPAGVGVASGDHLQLSAAKNLIVTAGGN
ADIGVLRRFTVAAGEAVSIFAQRLGMKLIAKGKVEVQSQGDEMELSALKDVTISSVDGRLVLSAAKEVWI
GAGGSYIKINGNRIENGTPGDILEKCAVWSKPSAASAQISSTLPNALPSERLVLNLASSPSAMAAVPQDV
PYKLYAQGALVAQGLTDPSGRILVDHEPSTQSYRLELANGVTYNIPVSEEFRGDAENGQLANQGFHFFEQ
GSNGDGHDRAVHRKTYYGLLNPATETSATEPQS
 
Nucleotide Sequence: 1782 bp     [Download]
>gi|377810593|ref|NC_016626.1|:413760-415541 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
ATCGCACGCCGGCGTCACGAAGAGCATCTGGCTACGCAGATTAGTTATCGGGGGCGTGGGAATCCGTTTT
CGCTCGAAATCGGCGAGGTGGTTGGCCTCGACGTGAACCCGATGGATGCGCCGCACGGTCTTTTTGTGAC
ATCGATCCGATGCGGCGGCGGCCGGGCCGTGTCGTACTGGTGCGCGTTTCGGGCGATTCCGGCGGATCGC
AGATGGCGGACCAGCATCGAATCGGTCAAGCGTCCGAAAATTGAAGGCGTGTTGCCCGCGCGAATCGATT
CGCCGGGAAAATACACCTATAGCTATGTGACCGAGAAAGGCCTGTACGTCGTCAAGATGCCGTTCGATCT
GGACGAGTGGAGTCCGGGCGGGCGCAGCCGTGCGATCCGCATGATGAGGCCGTATGCGGGGGCGAACTAC
GGGCATCATTTCCCGCTGATCGACGGGGCCAAAGTTGCGCTGATCTTCACTGCGCAAGACCCGGATAGGC
CAGTGATAGCCGGGTCACTTCATGACAGCCTGAATCCCGATCTCGTCAATAACCTTAACCATACGCGAAA
TATCCTTCGCACAGCGGCGCTCAATGAGATGCGCATGGAGGATAAGCGAGGGTTTGAGCATATTCACCTG
ACCACGCCGTTCCAGACCAGCGAACTGAATCTGGGGCACATGGTCGATGGAGATCGCAAGGAGAGGGGGC
GCGGCGCGGAGCTGAGGAGCGACGAGCACATAGCGCTGAGAGGGGGTAAAGGTGTGTTCATCTCGGCCGA
TACGCAGAATGCTGCGGGCGGCAAACAGCTTGACATGCAACCAGCTCAAGCCCTGCTCGAACAGGCGTTG
TTGCAGACGCAGTCCCTCGCGGAAGCTGCCAAGGCGGCACAGGCTATTGCAGCAGACTACGAGAATCAGA
AGGCGCTGCTTGACGGTACGCTGCGCGAACTGAAGAATGCGGCCGTGGTCGTCAGCGCTCCAGCGGGTGT
GGGTGTCGCATCGGGCGATCATCTGCAGCTAAGCGCAGCGAAGAACCTTATTGTCACAGCGGGCGGGAAT
GCCGATATCGGCGTGTTGCGACGTTTCACTGTCGCGGCGGGCGAAGCTGTGTCGATCTTCGCGCAACGGC
TGGGGATGAAGCTGATCGCCAAGGGCAAAGTCGAGGTGCAGTCGCAAGGCGACGAGATGGAGCTGTCGGC
GCTTAAGGACGTCACGATTTCCAGCGTGGACGGTCGACTCGTTCTTTCCGCAGCGAAGGAGGTCTGGATC
GGCGCGGGCGGTTCGTATATCAAGATCAACGGCAATCGCATCGAAAATGGGACACCAGGCGATATTCTTG
AGAAGTGCGCGGTGTGGAGCAAACCGAGTGCGGCGTCGGCGCAGATCAGCAGCACTTTGCCGAATGCCCT
TCCGTCCGAGCGACTCGTCCTTAACTTGGCATCGTCCCCTTCGGCGATGGCAGCCGTTCCGCAGGACGTT
CCCTACAAACTCTATGCGCAGGGCGCTTTGGTCGCACAAGGATTGACTGACCCGTCTGGACGCATTCTCG
TTGACCACGAGCCAAGCACACAGTCCTATCGGCTGGAGTTGGCAAACGGTGTGACCTACAACATCCCCGT
AAGCGAAGAGTTTCGCGGTGACGCTGAAAACGGTCAATTGGCGAATCAAGGCTTTCATTTCTTCGAGCAA
GGATCAAACGGGGATGGCCACGATCGCGCCGTTCACCGCAAGACTTACTACGGTCTTTTGAATCCCGCTA
CCGAAACCTCAGCTACGGAACCGCAATCATGA
 Primer design