SecReT6
Protein ID: 377810936
SecReT6 ID528
T6SS typeN/A
Gene symbol-
Locus tagBYI23_D003430
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]411970..412800 [+]
Producthypothetical protein
NoteTssI
UniProt IDG8MLX3
KEGG IDbyi:BYI23_D003430
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.70E-44, Aligned region: 30..265
Protein Sequence: 276 a.a.     [Download]
>gi|377810936|ref|YP_005043376.1| hypothetical protein BYI23_D003430 [Burkholderia sp. YI23]
MSMVLPSQAYSLVLKPQPAPISVLRWSCEAAISQLYKYTVEFTSAVDISKDEVVGRPATFSVEPEDPSAG
HLQQMFGERWKDFSKMPKRYDTHGIIQQFEVLGTSADETRYRVTLAPKIADLSRVRKSRLFQKQSVVEII
TDTLRHYGYRLGVDFDFLKLRGKYKRHEYITQYNESTFGFVQRLCAEEGLWFRFEQKHDRTIIVFGDDLD
AYARKQRIIPYRSHSGLESAGDESIRSLRTITQRVPEAIQLNDYNHRQADVNLLVEANAAPADKNP
 
Nucleotide Sequence: 831 bp     [Download]
>gi|377810593|ref|NC_016626.1|:411970-412800 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
ATGTCGATGGTGTTACCGAGTCAGGCATACAGCCTGGTCCTCAAACCACAACCCGCGCCCATATCCGTAT
TGCGCTGGTCGTGCGAAGCTGCTATCAGCCAGCTCTACAAGTACACGGTCGAGTTCACGAGCGCCGTGGA
TATCTCGAAGGATGAGGTTGTGGGACGGCCCGCGACATTCAGCGTCGAGCCCGAGGACCCCTCAGCAGGC
CATTTGCAGCAAATGTTCGGCGAGCGCTGGAAAGACTTCAGCAAGATGCCCAAACGCTATGACACGCATG
GGATCATCCAGCAATTCGAGGTACTCGGAACATCGGCCGATGAAACGCGGTATCGCGTCACGCTGGCGCC
GAAAATAGCTGATTTGTCAAGAGTTCGAAAAAGCAGACTATTCCAAAAGCAAAGCGTTGTCGAGATCATT
ACCGACACCCTGCGTCACTACGGCTATCGCTTGGGCGTGGACTTTGATTTCCTCAAGCTGCGCGGCAAGT
ACAAACGTCACGAATATATCACTCAGTATAACGAATCGACCTTCGGATTCGTACAACGGCTCTGTGCTGA
AGAGGGGTTGTGGTTCCGGTTCGAGCAAAAGCACGATCGAACGATCATCGTCTTTGGCGATGATCTGGAT
GCCTACGCCAGAAAGCAGCGGATCATTCCCTATCGCAGCCACTCGGGCCTCGAAAGCGCGGGTGACGAGT
CGATCCGCTCGCTCAGGACGATTACGCAGCGCGTGCCCGAAGCGATCCAGTTGAATGACTACAACCATCG
TCAGGCGGATGTGAACCTGCTGGTGGAGGCGAACGCTGCACCGGCGGATAAGAACCCTTAA
 Primer design