SecReT6
Protein ID: 377810938
SecReT6 ID528
T6SS typeN/A
Gene symbol-
Locus tagBYI23_D003450
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]413760..415541 [+]
Producthypothetical protein
NoteTssI
UniProt IDG8MLX5
KEGG IDbyi:BYI23_D003450
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 8.70E-46, Aligned region: 243..257
DUF2345 [PF10106], Evalue: 8.70E-46, Aligned region: 307..455
T6SS_Vgr [PF13296], Evalue: 2.60E-29, Aligned region: 185..290
T6SS_Vgr [PF13296], Evalue: 2.60E-29, Aligned region: 325..347
Phage_base_V [PF04717], Evalue: 1.20E-11, Aligned region: 103..179
Phage_base_V [PF04717], Evalue: 1.20E-11, Aligned region: 346..376
Sarcoglycan_1 [PF04790], Evalue: 0.0016, Aligned region: 237..259
Sarcoglycan_1 [PF04790], Evalue: 0.0016, Aligned region: 317..345
Sarcoglycan_1 [PF04790], Evalue: 0.0016, Aligned region: 376..421
Protein Sequence: 593 a.a.     [Download]
>gi|377810938|ref|YP_005043378.1| hypothetical protein BYI23_D003450 [Burkholderia sp. YI23]
MARRRHEEHLATQISYRGRGNPFSLEIGEVVGLDVNPMDAPHGLFVTSIRCGGGRAVSYWCAFRAIPADR
RWRTSIESVKRPKIEGVLPARIDSPGKYTYSYVTEKGLYVVKMPFDLDEWSPGGRSRAIRMMRPYAGANY
GHHFPLIDGAKVALIFTAQDPDRPVIAGSLHDSLNPDLVNNLNHTRNILRTAALNEMRMEDKRGFEHIHL
TTPFQTSELNLGHMVDGDRKERGRGAELRSDEHIALRGGKGVFISADTQNAAGGKQLDMQPAQALLEQAL
LQTQSLAEAAKAAQAIAADYENQKALLDGTLRELKNAAVVVSAPAGVGVASGDHLQLSAAKNLIVTAGGN
ADIGVLRRFTVAAGEAVSIFAQRLGMKLIAKGKVEVQSQGDEMELSALKDVTISSVDGRLVLSAAKEVWI
GAGGSYIKINGNRIENGTPGDILEKCAVWSKPSAASAQISSTLPNALPSERLVLNLASSPSAMAAVPQDV
PYKLYAQGALVAQGLTDPSGRILVDHEPSTQSYRLELANGVTYNIPVSEEFRGDAENGQLANQGFHFFEQ
GSNGDGHDRAVHRKTYYGLLNPATETSATEPQS
 
Nucleotide Sequence: 1782 bp     [Download]
>gi|377810593|ref|NC_016626.1|:413760-415541 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
ATCGCACGCCGGCGTCACGAAGAGCATCTGGCTACGCAGATTAGTTATCGGGGGCGTGGGAATCCGTTTT
CGCTCGAAATCGGCGAGGTGGTTGGCCTCGACGTGAACCCGATGGATGCGCCGCACGGTCTTTTTGTGAC
ATCGATCCGATGCGGCGGCGGCCGGGCCGTGTCGTACTGGTGCGCGTTTCGGGCGATTCCGGCGGATCGC
AGATGGCGGACCAGCATCGAATCGGTCAAGCGTCCGAAAATTGAAGGCGTGTTGCCCGCGCGAATCGATT
CGCCGGGAAAATACACCTATAGCTATGTGACCGAGAAAGGCCTGTACGTCGTCAAGATGCCGTTCGATCT
GGACGAGTGGAGTCCGGGCGGGCGCAGCCGTGCGATCCGCATGATGAGGCCGTATGCGGGGGCGAACTAC
GGGCATCATTTCCCGCTGATCGACGGGGCCAAAGTTGCGCTGATCTTCACTGCGCAAGACCCGGATAGGC
CAGTGATAGCCGGGTCACTTCATGACAGCCTGAATCCCGATCTCGTCAATAACCTTAACCATACGCGAAA
TATCCTTCGCACAGCGGCGCTCAATGAGATGCGCATGGAGGATAAGCGAGGGTTTGAGCATATTCACCTG
ACCACGCCGTTCCAGACCAGCGAACTGAATCTGGGGCACATGGTCGATGGAGATCGCAAGGAGAGGGGGC
GCGGCGCGGAGCTGAGGAGCGACGAGCACATAGCGCTGAGAGGGGGTAAAGGTGTGTTCATCTCGGCCGA
TACGCAGAATGCTGCGGGCGGCAAACAGCTTGACATGCAACCAGCTCAAGCCCTGCTCGAACAGGCGTTG
TTGCAGACGCAGTCCCTCGCGGAAGCTGCCAAGGCGGCACAGGCTATTGCAGCAGACTACGAGAATCAGA
AGGCGCTGCTTGACGGTACGCTGCGCGAACTGAAGAATGCGGCCGTGGTCGTCAGCGCTCCAGCGGGTGT
GGGTGTCGCATCGGGCGATCATCTGCAGCTAAGCGCAGCGAAGAACCTTATTGTCACAGCGGGCGGGAAT
GCCGATATCGGCGTGTTGCGACGTTTCACTGTCGCGGCGGGCGAAGCTGTGTCGATCTTCGCGCAACGGC
TGGGGATGAAGCTGATCGCCAAGGGCAAAGTCGAGGTGCAGTCGCAAGGCGACGAGATGGAGCTGTCGGC
GCTTAAGGACGTCACGATTTCCAGCGTGGACGGTCGACTCGTTCTTTCCGCAGCGAAGGAGGTCTGGATC
GGCGCGGGCGGTTCGTATATCAAGATCAACGGCAATCGCATCGAAAATGGGACACCAGGCGATATTCTTG
AGAAGTGCGCGGTGTGGAGCAAACCGAGTGCGGCGTCGGCGCAGATCAGCAGCACTTTGCCGAATGCCCT
TCCGTCCGAGCGACTCGTCCTTAACTTGGCATCGTCCCCTTCGGCGATGGCAGCCGTTCCGCAGGACGTT
CCCTACAAACTCTATGCGCAGGGCGCTTTGGTCGCACAAGGATTGACTGACCCGTCTGGACGCATTCTCG
TTGACCACGAGCCAAGCACACAGTCCTATCGGCTGGAGTTGGCAAACGGTGTGACCTACAACATCCCCGT
AAGCGAAGAGTTTCGCGGTGACGCTGAAAACGGTCAATTGGCGAATCAAGGCTTTCATTTCTTCGAGCAA
GGATCAAACGGGGATGGCCACGATCGCGCCGTTCACCGCAAGACTTACTACGGTCTTTTGAATCCCGCTA
CCGAAACCTCAGCTACGGAACCGCAATCATGA
 Primer design