SecReT6
Protein ID: 377810943
SecReT6 ID528
T6SS typeN/A
Gene symbol-
Locus tagBYI23_D003500
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]421405..421656 [+]
ProductPAAR motif-containing protein
NotePAAR
UniProt IDG8MLY0
KEGG IDbyi:BYI23_D003500
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 9.30E-25, Aligned region: 7..81
Protein Sequence: 83 a.a.     [Download]
>gi|377810943|ref|YP_005043383.1| PAAR motif-containing protein [Burkholderia sp. YI23]
MPNLILLGDATDHGGRVITASTTMIYEGRGVARKGDEVSCPKHLESKPNLIIDGDEETLDEGVPVARHGN
RAMCGCHLISSLL
 
Nucleotide Sequence: 252 bp     [Download]
>gi|377810593|ref|NC_016626.1|:421405-421656 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
ATGCCTAACCTGATTCTCCTCGGCGACGCCACCGACCACGGTGGCCGCGTCATCACCGCATCGACCACGA
TGATCTACGAAGGACGCGGCGTGGCGCGCAAGGGCGATGAAGTGAGCTGCCCGAAACATCTTGAGAGCAA
ACCGAACCTCATCATCGACGGTGACGAAGAGACGCTGGACGAAGGCGTGCCCGTCGCCCGCCACGGCAAT
CGCGCGATGTGTGGATGCCACCTCATCTCCAGTCTGCTCTGA
 Primer design