SecReT6
Protein ID: 377810945
SecReT6 ID528
T6SS typeN/A
Gene symbol-
Locus tagBYI23_D003520
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]422898..426428 [+]
Producthypothetical protein
NoteTssM
UniProt IDG8MLY2
KEGG IDbyi:BYI23_D003520
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.30E-78, Aligned region: 426..746
DUF1215 [PF06744], Evalue: 4.00E-32, Aligned region: 732..753
DUF1215 [PF06744], Evalue: 4.00E-32, Aligned region: 879..996
Protein Sequence: 1176 a.a.     [Download]
>gi|377810945|ref|YP_005043385.1| hypothetical protein BYI23_D003520 [Burkholderia sp. YI23]
MKFPKISSYWLLAGALTAGGAIFAWYNGESIDPSPYKRVMYVCVIGAFAVLARANLTGGWRRVVRIAPRD
GAKKHEREASARVKSTESTVTDVGSSRSEKLEMALRDRHGRRWRYRDRWIAVVGDEQVVERMTPGLIESG
FVVSASTVLLYARQSGDVLDTNWLEQIRAMRRGRPVDAMVAIEQSGAQSGPKLPGTQLSAQSTSPFDGQA
IAQKLARHARALRWAAPAYMLNVLDLGRNPLVSSAVVGETWSEAHVGATELNESLHALAARLADAGVARL
LVNSRDRFIGELSCHIDSLRHALTEMVAQAGVSLLARCSVHGLLFASLPIDKTAEELVSHADVKASVAGQ
RAQHPVWQAIADHSRKVHGRRVGFSLSTSAAWIVSGVIALWMLGTVVSGASNRASMQQASVTLTKLTSVQ
DPTQGLLALDALDKQIDTLEVHRTERAPWHARFGLNRDAALLDALQPSYHSATSRILIAPIKAKLEERLQ
QLASLSDAEIASGGNAQVQAAYDTLKTYLMLAHPEHVDAAFLATQMLATNAPTRPVNSSITSGTWEDLRQ
HAIAFYANHLERDSAPAITPDASLVAQTRQTIIGVRGIQNSTDAIYQQIIDEAKPKYPPVSLATLLGDHP
SRGLFNTSATVAGVFTRAAWDERMSKAIDEASEHRTVTGDWVLSDAKIDNTAPSTLKAELRRRYFEDYAR
AWAQFLNSIRWQNASSLSGTVDQLTLLGDPQRSPLVAMMNAIVYQASAGASTQSLSDNLISKAQSWVGKD
EKDPSRQTQAQLAPLASAFGPILRLTGSDIASNAPANAKTPQQSVGDLSLPRYLERVTAMRLKTQQMMAS
ADPDAMSRMAAQAMLQGKTSDIADSRDYASRLAASLGEQWSSFGHLFEAPLDQTWQVVVQPASASLNEIW
RTSIVADWNRTFGGRYPFADADNDASLPDMARFMRMDNGVIARFLATQLAGVIELQGDRWVAAQGTNQGS
LALDPAFLAGLNKLTHVSTTLFPSGDARIRFELRGVPTPGITDMKLIASGQQLHYFNQMEQWIPFEWPGQ
ALDNNAQLQWETEQGGLRSTMYAQGRFALIRLMERAKIEQQDNARYLLSWTPEQSLGIPLSLELRAEAGA
GPLDLLQLRHFTLPTRIFMTNAAKDGAKVSGPTPPPLPPGAIAAAQKVGVPLPGTK
 
Nucleotide Sequence: 3531 bp     [Download]
>gi|377810593|ref|NC_016626.1|:422898-426428 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
ATGAAGTTTCCCAAAATCTCCAGCTATTGGCTGCTTGCCGGCGCGCTCACTGCGGGCGGCGCGATCTTCG
CCTGGTACAACGGAGAAAGCATCGATCCATCGCCTTATAAGCGAGTGATGTACGTGTGCGTCATCGGCGC
GTTTGCGGTTTTGGCGCGTGCGAATCTTACCGGGGGGTGGCGCCGTGTCGTACGTATCGCGCCTCGTGAT
GGCGCCAAAAAACACGAACGCGAAGCATCCGCACGCGTGAAATCGACAGAGTCCACCGTTACCGACGTGG
GATCGTCACGCAGTGAGAAGCTGGAAATGGCGCTTCGTGATCGGCACGGACGACGTTGGCGCTATCGGGA
CCGTTGGATCGCGGTCGTCGGTGATGAACAAGTGGTCGAGCGTATGACGCCCGGACTGATAGAAAGCGGA
TTCGTGGTCTCCGCTTCGACGGTGCTGCTTTACGCGAGACAGAGTGGAGATGTGCTCGACACGAACTGGC
TTGAGCAGATCCGAGCGATGCGACGCGGCCGCCCCGTTGACGCGATGGTTGCGATCGAGCAGTCGGGTGC
TCAGTCAGGCCCCAAGTTACCAGGCACTCAACTCAGCGCGCAGTCGACCAGCCCATTCGATGGACAGGCC
ATCGCGCAAAAGCTGGCTCGTCACGCCCGCGCGCTTCGTTGGGCCGCGCCTGCGTACATGCTTAACGTGC
TTGATTTGGGGCGCAACCCCTTGGTGAGCTCCGCGGTAGTCGGTGAAACGTGGAGCGAGGCCCATGTGGG
TGCGACTGAGCTCAATGAATCGCTGCACGCGTTGGCGGCGCGTCTCGCCGATGCAGGTGTAGCGCGTCTT
CTCGTCAATTCCCGAGATCGCTTCATCGGCGAGCTGTCATGTCATATCGACAGTTTGCGACATGCACTGA
CCGAAATGGTGGCTCAAGCCGGTGTATCGCTTCTTGCGCGATGCTCCGTGCACGGTCTGTTATTTGCATC
GCTTCCGATCGACAAGACGGCTGAAGAGTTGGTCAGCCACGCGGATGTGAAAGCATCGGTCGCCGGACAG
AGAGCGCAACATCCAGTCTGGCAAGCCATTGCGGATCACAGCCGCAAGGTTCACGGTCGGCGTGTGGGCT
TTTCGCTTTCGACGTCAGCGGCATGGATCGTGAGCGGTGTTATCGCGCTATGGATGCTCGGCACCGTGGT
TTCTGGTGCATCGAATCGTGCGTCGATGCAGCAAGCGTCGGTGACGTTGACTAAGCTCACGTCCGTGCAA
GACCCGACGCAAGGACTACTCGCCCTCGACGCGCTTGACAAGCAAATCGACACGCTGGAGGTCCATCGCA
CAGAGCGTGCGCCGTGGCACGCCCGTTTCGGTTTAAACCGTGACGCTGCTTTATTGGATGCGCTTCAGCC
CAGCTATCACAGTGCCACCTCGCGCATACTCATCGCCCCAATCAAAGCAAAGCTCGAAGAACGTCTGCAA
CAACTCGCCTCGCTCTCCGACGCCGAAATCGCCAGCGGCGGCAACGCGCAAGTGCAGGCCGCCTACGACA
CGCTCAAGACGTACCTGATGCTCGCGCATCCCGAGCATGTCGATGCAGCGTTTCTCGCAACGCAAATGCT
CGCGACCAACGCACCTACCCGTCCGGTCAATTCATCGATCACTTCCGGTACGTGGGAAGACCTGCGCCAG
CACGCCATCGCCTTCTATGCGAATCACCTTGAACGAGACTCAGCGCCCGCCATCACGCCAGATGCATCAC
TCGTCGCACAGACGCGCCAAACCATCATCGGCGTACGCGGCATCCAGAATTCGACCGACGCGATCTACCA
GCAGATCATCGACGAAGCGAAGCCGAAATACCCGCCAGTCAGTCTTGCCACGCTCCTGGGCGATCACCCC
AGCCGGGGCCTTTTCAACACGAGCGCGACCGTTGCCGGCGTATTCACCCGCGCCGCATGGGACGAGCGCA
TGTCGAAGGCGATCGACGAAGCGAGCGAACATCGCACGGTTACCGGCGATTGGGTGCTGTCGGACGCCAA
GATCGATAACACCGCGCCCTCAACGCTTAAAGCTGAATTGCGCCGACGCTACTTCGAGGACTACGCGCGC
GCCTGGGCGCAATTCCTGAACAGTATCCGCTGGCAGAACGCCTCGTCGCTTTCGGGCACGGTCGATCAGT
TGACGCTCCTCGGCGATCCGCAACGCTCGCCGCTCGTCGCGATGATGAATGCGATCGTCTATCAGGCGAG
CGCCGGCGCGTCGACGCAATCGCTCTCGGACAATCTCATCAGCAAGGCGCAATCGTGGGTCGGCAAGGAC
GAGAAGGACCCGTCCAGGCAGACTCAGGCGCAGCTAGCGCCTTTGGCGAGCGCGTTCGGCCCGATCCTGC
GCCTGACGGGAAGCGATATCGCGAGCAACGCACCCGCCAACGCTAAAACGCCACAGCAAAGTGTCGGCGA
CCTGAGCCTGCCGCGCTACCTCGAACGCGTGACGGCCATGCGCCTGAAGACACAGCAGATGATGGCCAGC
GCCGACCCCGATGCGATGTCGCGCATGGCCGCGCAGGCGATGCTGCAAGGCAAGACCTCGGACATCGCCG
ACAGCCGCGACTACGCGAGCCGGCTCGCCGCGAGCCTGGGAGAGCAGTGGTCCAGCTTTGGACACCTGTT
CGAAGCGCCGCTGGACCAGACGTGGCAGGTTGTCGTGCAGCCCGCATCGGCGAGCCTGAACGAGATCTGG
CGGACGTCCATCGTCGCTGATTGGAATCGCACCTTCGGCGGACGTTACCCATTCGCAGACGCAGACAACG
ATGCCTCGCTGCCCGACATGGCGCGTTTCATGCGCATGGACAACGGTGTGATCGCCCGATTCCTCGCGAC
GCAACTGGCTGGCGTGATCGAGCTTCAGGGCGATCGTTGGGTCGCGGCGCAAGGCACGAATCAAGGCTCG
CTCGCGCTCGATCCCGCGTTCCTCGCGGGCCTGAACAAGCTCACTCACGTCTCGACGACGTTATTCCCCT
CAGGCGACGCCCGCATACGCTTCGAATTGCGCGGCGTACCGACACCCGGCATCACGGACATGAAGCTGAT
CGCATCGGGCCAGCAGTTGCACTACTTCAACCAGATGGAACAGTGGATTCCGTTCGAGTGGCCGGGCCAG
GCGCTGGATAACAACGCGCAACTGCAATGGGAAACGGAGCAGGGCGGCCTGCGCTCGACAATGTACGCGC
AAGGCCGTTTCGCGCTCATCCGGCTGATGGAGCGCGCAAAAATCGAGCAGCAGGACAACGCGCGCTATCT
GCTGTCGTGGACGCCGGAACAGAGCCTTGGAATTCCTCTTTCGTTGGAGCTTCGCGCCGAAGCGGGTGCG
GGTCCGCTCGACTTGCTGCAACTACGCCACTTCACATTGCCCACGCGCATCTTCATGACGAACGCAGCCA
AAGACGGTGCGAAGGTTTCCGGACCGACGCCGCCGCCCTTGCCACCGGGCGCCATCGCCGCCGCGCAGAA
GGTCGGCGTACCACTTCCGGGGACGAAATAA
 Primer design