SecReT6
Protein ID: 377810946
SecReT6 ID528
T6SS typeN/A
Gene symbol-
Locus tagBYI23_D003530
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]426428..428260 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDG8MLY3
KEGG IDbyi:BYI23_D003530
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.30E-180, Aligned region: 16..604
Protein Sequence: 610 a.a.     [Download]
>gi|377810946|ref|YP_005043386.1| type VI secretion protein [Burkholderia sp. YI23]
MNDDIDQDVHHPDPVLRYYEAEMRYLREAGREFARAHPDRARMLNLDRVGDRDPYVERLYEGFAFLTGRL
HQKLDDELPELTEGLVSLLWPHYLRMIPSLSVVELIPLGEKHQRTEHVPAGVPVRSAPIGVPKEGETATH
RTVQCLYRTTQPVELHPLRLLQAGATVRHDGRSVIRLAFELDHSANRKETDLSRLRLYLNADQPTAFAMH
LALTRQVHAMEWRIPEIRDGEALPLQGVTIEPAGFSPEERLWPKSDAAFSGYQLLLEYFTFREKFLFVDL
CGLDVEKLPEDSTRFELEIVLTHPYPSDQRFNKDNVRLFCTPVINLFELDAEPIVIDHHETEYRVVPAGY
QGEHVETYSVDAVEAFDHVTSERYEYVPFATFRHRGGMMRHESPERYFHTRVRPGMDGLHETWVIFGGNA
WETMQDLPEESVSLHVTGTNGMLPRKGLREARIDELAASTPNVAGVRNLIAPTLPLYPPTGDRFQWRVLS
HLAPNFLSMMNAEVLRGALALYDWTHDELNRRRLAGILHVSEALLEEVTGGAVERGVLIEVTLDSHAFSG
EGDVMLFGELLHRFFELYAEINLFTKLAIVSLPSQARIEWPRSKTWRAPL
 
Nucleotide Sequence: 1833 bp     [Download]
>gi|377810593|ref|NC_016626.1|:426428-428260 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
ATGAACGACGATATCGACCAGGACGTCCACCATCCCGATCCCGTTCTACGCTACTACGAAGCCGAAATGC
GCTATCTGCGCGAGGCGGGACGTGAGTTCGCGCGCGCGCATCCGGACCGCGCACGCATGCTTAATCTCGA
TCGCGTCGGCGACCGCGATCCGTACGTCGAACGACTCTATGAAGGCTTCGCGTTCCTGACCGGCCGTCTC
CACCAAAAGCTCGACGACGAGCTGCCGGAACTGACCGAAGGTCTCGTGAGCCTGCTATGGCCGCACTATC
TGCGGATGATTCCGTCGCTCTCGGTGGTCGAGCTGATCCCGCTCGGAGAAAAGCACCAGCGCACCGAACA
CGTGCCGGCGGGCGTCCCAGTGCGCTCGGCGCCGATCGGCGTGCCCAAAGAGGGCGAAACGGCGACGCAC
CGAACCGTCCAGTGCCTGTATCGCACGACGCAGCCGGTCGAATTGCACCCGCTGCGCTTGCTCCAGGCCG
GCGCCACGGTGCGTCACGACGGCCGCTCGGTGATCCGGCTGGCCTTCGAACTGGATCACTCCGCGAACCG
GAAGGAAACAGATCTATCGCGCCTGCGCCTCTATCTGAACGCAGACCAACCGACGGCCTTCGCGATGCAC
CTCGCGCTCACCCGTCAGGTCCACGCGATGGAATGGCGCATCCCCGAAATCCGCGACGGCGAAGCGTTGC
CGCTGCAAGGCGTGACGATCGAACCAGCCGGCTTCTCGCCTGAAGAGCGCCTCTGGCCCAAATCCGACGC
CGCCTTCTCCGGCTATCAGTTGCTGCTCGAATACTTCACCTTCCGCGAGAAATTCCTGTTCGTCGATCTA
TGCGGACTGGATGTCGAAAAGCTTCCGGAGGACTCGACGCGCTTCGAACTGGAGATCGTGCTCACACATC
CGTATCCGTCCGATCAGCGCTTCAACAAGGACAACGTGCGCCTCTTCTGCACGCCCGTCATCAACCTGTT
CGAACTCGATGCGGAGCCCATCGTCATCGATCATCACGAGACGGAGTATCGCGTGGTGCCTGCGGGCTAT
CAGGGCGAACACGTCGAAACCTATTCCGTCGATGCGGTCGAAGCGTTCGATCACGTGACCTCCGAGCGCT
ACGAGTACGTGCCGTTCGCGACCTTCCGGCATCGCGGCGGCATGATGCGCCATGAATCGCCCGAACGTTA
CTTTCATACGCGCGTGCGCCCCGGCATGGATGGACTGCATGAAACGTGGGTGATCTTCGGCGGCAACGCG
TGGGAGACGATGCAGGATTTGCCTGAAGAAAGCGTGTCATTGCACGTCACTGGCACGAACGGCATGTTGC
CGCGCAAGGGCTTGCGCGAGGCACGCATCGACGAGTTGGCGGCGAGCACGCCGAACGTCGCGGGCGTGCG
CAATCTCATCGCGCCGACCTTGCCGCTCTATCCGCCGACGGGCGACCGTTTCCAGTGGCGCGTGCTCTCG
CATCTCGCGCCGAACTTCTTGTCGATGATGAACGCGGAAGTGCTGCGCGGTGCGCTCGCGCTCTACGACT
GGACCCACGATGAACTGAATCGCCGGCGGCTCGCGGGCATCCTGCACGTATCCGAAGCGTTGCTCGAAGA
AGTCACGGGCGGCGCGGTGGAGCGCGGCGTGCTTATCGAAGTGACGCTCGATTCGCACGCGTTCTCGGGC
GAGGGCGATGTGATGCTCTTCGGTGAACTGCTGCATCGCTTCTTCGAGTTGTACGCGGAGATCAATCTCT
TTACGAAACTCGCTATCGTGAGCCTGCCCTCGCAGGCCCGCATCGAATGGCCGCGCAGCAAGACGTGGAG
AGCGCCGCTATGA
 Primer design