SecReT6
Protein ID: 377810947
SecReT6 ID528
T6SS typeN/A
Gene symbol-
Locus tagBYI23_D003540
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]428242..429306 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDG8MLY4
KEGG IDbyi:BYI23_D003540
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.50E-88, Aligned region: 17..326
Protein Sequence: 354 a.a.     [Download]
>gi|377810947|ref|YP_005043387.1| type VI secretion protein [Burkholderia sp. YI23]
MESAAMTLEPLVAALLARAPQMNFMQLCRLLEARAPDQPGFAQRDTPEHEPVRFRPRPRMGFPAGEMASV
EFDDSDGTRFPPTVRTTFLGLYGVDAVMPTHYLDDIVQREEGHEAVEAFLDQFNHRFVTLLYRAWKKYRY
PESFRHGGADAHSKSLLCLAGFGWGNKPARAGLPDARTLALLGLLIQRTRTPEGLSGVIALGAPGVDVRV
DEFFAVARRNDKSTPLSTKSSDSARGLGGGYVLGKRLRYRSRAVRVTLKPQDAQQARDLLPGGWLHRDLM
ALVRLYIGVKADVHLRMQMSSRFAPEPSVGKQQMTVAPRLGWTVVLPAQQERVVTVELGVCEAFPMPQPN
PYLQ
 
Nucleotide Sequence: 1065 bp     [Download]
>gi|377810593|ref|NC_016626.1|:428242-429306 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
GTGGAGAGCGCCGCTATGACACTCGAACCGCTGGTGGCGGCGCTGCTCGCACGCGCGCCGCAGATGAACT
TCATGCAGCTATGCCGGCTGCTGGAAGCGCGTGCGCCCGATCAGCCGGGTTTCGCCCAGCGCGATACGCC
CGAGCACGAGCCGGTACGTTTCCGTCCGCGTCCGCGCATGGGCTTTCCGGCGGGGGAGATGGCGAGCGTC
GAGTTCGACGACAGCGACGGAACGCGATTTCCGCCAACGGTACGCACGACATTCCTCGGCCTGTACGGTG
TCGATGCGGTCATGCCCACGCATTACCTCGACGACATCGTTCAGCGCGAAGAAGGCCACGAAGCGGTCGA
AGCGTTTCTCGACCAGTTCAACCATCGCTTCGTGACGCTGCTGTATCGCGCGTGGAAGAAGTATCGCTAT
CCGGAGAGCTTCCGCCATGGCGGTGCGGACGCGCATTCGAAAAGCCTGCTATGTCTCGCCGGTTTCGGAT
GGGGCAACAAGCCTGCGCGCGCAGGCTTGCCGGATGCGCGCACGCTGGCCCTGCTCGGGCTGTTGATTCA
ACGCACGCGCACGCCAGAGGGTCTGTCCGGCGTGATCGCGTTGGGCGCGCCCGGCGTCGATGTGCGCGTC
GATGAGTTTTTTGCGGTGGCCAGGCGCAATGACAAAAGCACGCCGCTGAGCACGAAGAGCAGCGATAGCG
CGCGCGGCCTGGGCGGCGGCTATGTGCTGGGCAAGCGGCTGCGCTATCGCAGCCGCGCGGTACGTGTGAC
GCTCAAACCACAAGACGCGCAACAGGCGCGTGATCTCCTGCCGGGCGGCTGGCTGCATCGCGATTTGATG
GCCTTGGTGAGGCTCTACATCGGCGTGAAAGCCGATGTGCATCTGCGCATGCAGATGTCGTCGCGTTTTG
CGCCCGAGCCTTCCGTGGGCAAGCAACAGATGACGGTTGCGCCCCGGCTCGGCTGGACGGTCGTGCTGCC
GGCCCAGCAAGAGCGCGTCGTCACGGTCGAGTTGGGCGTGTGCGAAGCGTTTCCGATGCCGCAGCCGAAT
CCCTATTTGCAGTAA
 Primer design