SecReT6
Protein ID: 377810948
SecReT6 ID528
T6SS typeN/A
Gene symbol-
Locus tagBYI23_D003550
StrainBurkholderia sp. YI23
Repliconplasmid byi_1p [GenBank: NC_016626] [Browse all T6SS(s) in this replicon]
Location [Strand]429309..429836 [+]
Producthypothetical protein
NoteTssJ
UniProt IDG8MLY5
KEGG IDbyi:BYI23_D003550
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 5.90E-36, Aligned region: 14..163
Protein Sequence: 175 a.a.     [Download]
>gi|377810948|ref|YP_005043388.1| hypothetical protein BYI23_D003550 [Burkholderia sp. YI23]
MSNRNIAVSVALTLLLSGCGVWQAASNTTAAAYDTVFHNLGKAVDIDLTADANVNPDSAGHPRSVAVRVY
QLKDRKRFDETSYADLISNDTTALGPDLQSSMAVVVNPGGAASVSQPMKKDTKFIAIAAIFQTADKPATW
KQVVPVKKLPADAPLKLTLTNKTLDVDRDLAPRKP
 
Nucleotide Sequence: 528 bp     [Download]
>gi|377810593|ref|NC_016626.1|:429309-429836 Burkholderia sp. YI23 plasmid byi_1p, complete sequence
ATGTCGAATAGAAATATCGCAGTCAGCGTAGCGCTGACGCTCCTTCTCTCCGGATGCGGCGTCTGGCAAG
CCGCATCCAATACTACGGCGGCCGCCTACGACACTGTGTTCCACAATCTCGGCAAAGCGGTAGACATCGA
TTTGACGGCCGACGCCAATGTGAATCCTGACAGCGCCGGTCATCCGCGATCGGTCGCGGTGCGCGTATAT
CAGTTGAAGGATCGCAAACGCTTCGATGAAACGTCATATGCCGATCTGATCAGCAACGACACGACGGCGC
TAGGGCCAGACCTACAGTCGAGCATGGCGGTGGTGGTGAACCCCGGCGGCGCCGCGAGCGTATCGCAACC
GATGAAGAAAGACACAAAGTTCATCGCGATCGCCGCGATCTTCCAGACCGCCGATAAACCCGCGACGTGG
AAGCAGGTCGTGCCCGTCAAGAAGCTGCCCGCCGACGCGCCACTGAAACTGACGCTAACGAACAAGACAC
TCGACGTGGATCGCGATCTCGCGCCGCGCAAGCCCTGA
 Primer design