SecReT6
Protein ID: 378443714
SecReT6 ID550
T6SS typei3
Gene symbol-
Locus tagSTMMW_02671
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. D23580
Repliconchromosome [GenBank: NC_016854] [Browse all T6SS(s) in this replicon]
Location [Strand]308608..309102 [-]
Productputative type VI system cytoplasmic protein
NoteTssE
UniProt IDC9X7A8
KEGG IDsev:STMMW_02671
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.40E-22, Aligned region: 35..147
Protein Sequence: 164 a.a.     [Download]
>gi|378443714|ref|YP_005231346.1| putative type VI system cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. D23580]
MSTSRFTPANHLLPTLFDRLCDNAPYQKIDRDISVTPVQLKEIIRRDLSFLLNTISHEGDIDARRYPQAA
ASVLNYGLPPLAGSFMYEHKWDDISEAIRRAIIRFEPRLNAATLRVTPLLDKTRQGSYNTLQFEIRGQIL
TQPYPTEFLVRSALDMELSRITFF
 
Nucleotide Sequence: 495 bp     [Download]
>gi|378443454|ref|NC_016854.1|:c309102-308608 Salmonella enterica subsp. enterica serovar Typhimurium str. D23580
ATGAGCACGTCTCGTTTTACACCCGCTAACCACCTGCTGCCCACGCTGTTTGATCGGCTGTGTGACAATG
CTCCGTATCAGAAAATTGACCGGGATATCAGCGTCACGCCGGTACAACTGAAGGAGATCATTCGCCGGGA
TCTCTCCTTTTTGCTCAATACCATTAGCCACGAGGGTGACATCGACGCCCGGCGCTATCCGCAGGCGGCG
GCGTCAGTGCTCAACTATGGCCTGCCGCCGCTGGCGGGCAGCTTTATGTATGAGCATAAGTGGGACGATA
TCAGCGAGGCGATCCGGCGCGCCATTATCCGTTTCGAACCCCGGCTGAACGCCGCCACACTCAGGGTCAC
GCCCTTGCTCGATAAAACCCGGCAGGGTAGCTATAACACGCTACAGTTTGAAATTCGCGGACAAATTCTG
ACGCAGCCGTATCCCACGGAGTTTCTGGTACGCAGCGCGCTGGATATGGAGCTGAGCCGCATTACGTTCT
TTTAA
 Primer design