SecReT6
Protein ID: 378443719
SecReT6 ID550
T6SS typei3
Gene symbol-
Locus tagSTMMW_02741
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. D23580
Repliconchromosome [GenBank: NC_016854] [Browse all T6SS(s) in this replicon]
Location [Strand]314485..315978 [+]
Producttype VI system secreted protein
NoteTssC
UniProt IDC9X7B3
KEGG IDsev:STMMW_02741
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.30E-191, Aligned region: 64..490
Protein Sequence: 497 a.a.     [Download]
>gi|378443719|ref|YP_005231351.1| type VI system secreted protein [Salmonella enterica subsp. enterica serovar Typhimurium str. D23580]
MANSNMQATDAVAQDTASASGEFDALLNQAFRPKTTQAAKAVEAAVQTLANTITVSDDAYKSISAIIAQI
DFKLTEQIKLILQHPDWQKLESSWRGMEHLVYNTETDEKLKIRFMNLSKDELRRNMKRYKGIAWDQSPMF
KKLYEAEYGQLGGEPYGCIIADYYFDHTPPDVDLLGSIAKVAASAHAPFIAGASPSVLQMDSWQELANPR
DLTKIVTQNLEYAPWNSLRASEDSRYIGLTMPRFLARLPYGAKTNPVDEFDFEEDADGSDHTKYVWSNAA
YAMGVNINRSFKHYGWCTLIRGVESGGAVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFIPL
IHRKNSDYAAFIGAQSLQKPQEYYDPDATANANLSARLPYLFACSRFAHFLKCIVRDKIGSFKEREDMQR
WLNEWIMNYVDADPVNSSQETKARRPLAAAEVVVEEVEGNPGYYDAKFFLRPHFQLEGLTGSLRLVTKLP
SVKQGNA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|378443454|ref|NC_016854.1|:314485-315978 Salmonella enterica subsp. enterica serovar Typhimurium str. D23580
ATGGCAAACAGTAATATGCAGGCAACCGACGCGGTTGCTCAGGATACCGCCTCCGCATCCGGTGAATTTG
ATGCGTTGCTGAATCAGGCCTTCCGACCCAAGACTACCCAGGCGGCAAAAGCCGTGGAAGCCGCGGTGCA
GACGCTGGCGAACACGATCACCGTCAGCGATGACGCCTATAAAAGCATCAGCGCTATTATTGCGCAGATC
GACTTTAAACTGACCGAACAGATCAAACTGATCCTGCAACATCCCGACTGGCAGAAGCTGGAATCCTCGT
GGCGCGGTATGGAGCATCTGGTTTACAACACCGAGACCGACGAAAAGCTGAAAATTCGCTTCATGAATCT
GTCAAAAGATGAATTGCGGCGCAACATGAAGCGTTACAAGGGCATCGCCTGGGATCAAAGCCCGATGTTC
AAGAAACTGTATGAAGCCGAATACGGCCAGTTAGGTGGCGAACCTTATGGCTGTATCATTGCGGATTACT
ACTTCGACCATACACCGCCCGATGTGGATCTGCTTGGCTCTATCGCCAAAGTCGCCGCGTCGGCCCATGC
GCCGTTTATTGCCGGGGCTTCCCCCTCGGTACTGCAAATGGACTCCTGGCAGGAACTGGCGAATCCCCGC
GACCTGACCAAAATCGTCACCCAGAACCTGGAATATGCGCCGTGGAACTCGCTGCGGGCTAGCGAAGACT
CCCGTTATATTGGCCTGACGATGCCGCGTTTTCTTGCCCGCCTGCCGTATGGCGCAAAAACCAACCCGGT
GGACGAGTTTGATTTTGAAGAAGATGCGGATGGTTCTGACCATACCAAATACGTCTGGAGCAACGCGGCC
TACGCGATGGGCGTAAACATCAACCGTTCCTTCAAACACTACGGCTGGTGTACGTTGATTCGCGGTGTGG
AATCAGGCGGTGCGGTGGAAAATCTTCCCTGCCATACCTTCCCGACTGACGATGGCGGCGTGGACATGAA
ATGCCCGACCGAAATCGCCATCTCTGACCGCCGCGAGGCTGAACTGGCGAAAAACGGTTTTATCCCGTTG
ATCCACCGTAAAAACTCAGACTATGCCGCCTTTATCGGCGCACAGTCGCTGCAAAAACCACAGGAATACT
ACGATCCGGACGCGACGGCCAACGCTAACCTGTCTGCCCGTCTACCGTACCTGTTCGCCTGCTCGCGCTT
CGCTCACTTCCTCAAATGTATCGTCCGCGACAAAATCGGTTCCTTTAAAGAGCGTGAGGATATGCAGCGC
TGGCTAAATGAATGGATTATGAATTATGTCGACGCCGATCCGGTGAACTCCTCGCAAGAAACTAAAGCCC
GTCGTCCGCTGGCTGCCGCTGAAGTAGTGGTGGAAGAGGTCGAAGGCAATCCAGGTTATTACGACGCGAA
ATTCTTCCTGCGTCCGCATTTCCAGCTTGAAGGGCTGACGGGATCGCTGCGCCTGGTGACAAAACTGCCG
TCAGTGAAGCAGGGCAATGCCTGA
 Primer design