SecReT6
Protein ID: 378443726
SecReT6 ID550
T6SS typei3
Gene symbol-
Locus tagSTMMW_02851
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. D23580
Repliconchromosome [GenBank: NC_016854] [Browse all T6SS(s) in this replicon]
Location [Strand]319202..319738 [+]
Productputative lipoprotein
NoteTssJ
UniProt IDC9X7C0
KEGG IDsev:STMMW_02851
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.10E-41, Aligned region: 20..170
Protein Sequence: 178 a.a.     [Download]
>gi|378443726|ref|YP_005231358.1| putative lipoprotein [Salmonella enterica subsp. enterica serovar Typhimurium str. D23580]
MNEWRNPTRWLCAVAMPFALLLLSGCGSSDALPDLESQRLDLSVKASDKVNPDNQKKAAPIEIRVYELKN
DAAFTTADYWSLHDNDKSVLTDDLVRRDSFILRPGEEKKLRRPLNAQTTAIGVLAGYRNLAKSVWRVTYK
IPEAPEKAWYSSFISGKGKVQLEAELEQSAIVITERDK
 
Nucleotide Sequence: 537 bp     [Download]
>gi|378443454|ref|NC_016854.1|:319202-319738 Salmonella enterica subsp. enterica serovar Typhimurium str. D23580
GTGAATGAATGGCGTAACCCCACTCGGTGGTTATGTGCGGTAGCTATGCCTTTTGCACTGCTCCTGCTTT
CCGGATGCGGCAGTAGCGATGCGTTACCTGACCTCGAATCACAGCGACTCGACCTGAGCGTGAAAGCCTC
CGATAAGGTGAATCCTGACAATCAGAAGAAGGCCGCGCCCATTGAGATACGTGTTTATGAACTGAAAAAT
GACGCCGCTTTCACGACAGCTGATTACTGGTCGCTCCATGACAACGACAAATCCGTCCTTACCGACGATT
TAGTGCGTCGCGACAGCTTTATTTTGCGTCCCGGCGAAGAGAAAAAACTGCGTCGCCCGCTGAATGCGCA
GACCACGGCAATCGGCGTACTGGCCGGATACCGTAACCTGGCCAAATCGGTCTGGCGGGTAACCTACAAA
ATCCCGGAAGCCCCGGAAAAAGCCTGGTACAGCAGCTTCATATCGGGGAAAGGAAAAGTGCAGTTGGAGG
CGGAACTGGAACAAAGCGCCATTGTAATTACGGAACGGGATAAATGA
 Primer design