SecReT6
Protein ID: 378443735
SecReT6 ID550
T6SS typei3
Gene symbol-
Locus tagSTMMW_02941
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. D23580
Repliconchromosome [GenBank: NC_016854] [Browse all T6SS(s) in this replicon]
Location [Strand]329844..332033 [+]
Productputative type VI system protein
NoteTssI
UniProt IDC9X7C9
KEGG IDsev:STMMW_02941
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-79, Aligned region: 121..429
Phage_base_V [PF04717], Evalue: 1.60E-26, Aligned region: 467..559
Phage_base_V [PF04717], Evalue: 1.60E-26, Aligned region: 663..685
Protein Sequence: 729 a.a.     [Download]
>gi|378443735|ref|YP_005231367.1| putative type VI system protein [Salmonella enterica subsp. enterica serovar Typhimurium str. D23580]
MSFVSTNNKSGMGGLTTTTPPITGESGGVTADSVAGSVADAAESAVEQAAGSLFGALPEPSGLVKAAVAA
AQAAAAAGMAQDAVSAIVSAVAGGPGAHNVTVSGSAVPPGALLFASLDGGETLSELFSYVVQLKTPDTLN
LGYVSPAANLPLKPMVGKDLCVNIELDGGGKRHISGLVTAARVVGHEGRSVTYELRMEPWVKLLTHTSDY
KAFQNKTVVDILDEVLAEYPYPVEKRLVESYPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSEDSHTL
VLADAISAHKACPDSPLVEWHQEGLKLDKEFIHTITANESLRTGQWVLDDFDFTKPRSLLANTVANPRET
GHATYEHYEWPGDYFDKSEGEMLTRIRMEAQRSPGSRVLGGGNIRTLMTGYTFTLENYPTAEVNQEYLLM
QTLLFVQDNAQHSGQDQHFTFSTRFELHPTREVFRPQRTVSKPHTKGPQSAIVTGPAGQEIWTDQYGRVK
VQFGWDRYGKMDENSTCWIRVSYPWAGKGFGMIQIPRIGQEVLVDFKNGDPDLPIIVGRTYNQDTMPPWG
LPGMASQSGIFSHSLYGGPTNGNMLRFDDKTGAEEVKFHAEKDLNTTVKNNETHTVMVDRTKTIIKNETN
SIGEDRNTTVTKNDGLSVKLAQTINIGTTYRLDVGDQFTLRCGNAALVLHKDGSIEFCGKQLMLHTSDVM
QLIGKGIDMNPDGGTAVTADDIAPLLTSE
 
Nucleotide Sequence: 2190 bp     [Download]
>gi|378443454|ref|NC_016854.1|:329844-332033 Salmonella enterica subsp. enterica serovar Typhimurium str. D23580
ATGAGTTTTGTATCCACAAATAATAAATCCGGTATGGGAGGGCTGACGACAACCACGCCGCCGATAACCG
GAGAAAGTGGCGGTGTCACCGCAGATTCAGTCGCCGGAAGCGTGGCAGATGCGGCGGAATCCGCCGTGGA
ACAGGCTGCGGGATCGCTATTTGGCGCATTGCCGGAGCCATCAGGACTGGTGAAAGCCGCGGTAGCAGCG
GCGCAGGCTGCCGCCGCCGCAGGTATGGCGCAGGATGCGGTATCGGCCATCGTCTCTGCTGTTGCAGGCG
GGCCGGGGGCGCATAATGTGACGGTCAGCGGCAGCGCCGTACCGCCGGGCGCATTACTGTTCGCCAGCCT
GGACGGCGGCGAAACATTAAGTGAACTGTTCAGCTATGTGGTACAGCTAAAAACGCCCGACACCCTGAAT
CTGGGCTATGTCTCCCCGGCGGCCAACCTGCCGCTCAAACCGATGGTGGGCAAAGATCTGTGCGTCAACA
TCGAACTGGATGGTGGCGGTAAACGACATATCAGCGGGCTGGTCACGGCGGCGCGGGTGGTGGGCCATGA
AGGGCGTTCGGTTACCTATGAGCTGCGTATGGAGCCGTGGGTAAAACTGCTGACCCATACCAGCGACTAC
AAAGCATTCCAGAATAAAACCGTGGTGGATATTCTGGATGAGGTTCTGGCGGAATATCCCTACCCGGTGG
AAAAGCGGCTGGTGGAAAGCTACCCGGTACGCACCTGGCAGGTGCAGTACGGTGAAACTGATTTTGATTT
TCTTCAGCGACTGATGCAGGAGTGGGGCATCTACTGGTGGTTTGAGCACAGCGAGGACAGCCACACGCTG
GTGCTGGCGGATGCCATCAGCGCCCACAAAGCATGTCCGGACTCGCCGCTGGTCGAGTGGCACCAGGAAG
GGCTGAAGCTGGACAAGGAGTTTATCCACACTATCACGGCAAACGAGAGCCTGCGGACTGGACAGTGGGT
GCTGGATGATTTCGATTTTACGAAGCCACGTTCATTGCTGGCAAACACCGTGGCAAACCCGCGTGAAACC
GGTCATGCCACCTACGAGCATTATGAGTGGCCGGGAGACTACTTCGACAAGAGTGAAGGCGAGATGCTGA
CGCGCATTCGTATGGAAGCGCAGCGCAGCCCCGGCAGTCGGGTGCTGGGGGGAGGGAATATCCGCACACT
CATGACCGGTTATACCTTCACGCTGGAAAACTATCCCACCGCCGAAGTCAATCAGGAATATCTGCTGATG
CAGACCTTGCTGTTTGTGCAGGACAACGCGCAGCACAGCGGGCAGGACCAGCACTTTACCTTTTCCACCC
GTTTTGAACTGCACCCCACCCGCGAGGTGTTCCGCCCGCAGCGGACGGTGAGCAAACCCCACACCAAAGG
GCCGCAGAGCGCCATCGTCACCGGCCCGGCGGGCCAGGAAATCTGGACGGATCAGTACGGGCGGGTAAAG
GTACAGTTTGGTTGGGATCGCTACGGCAAAATGGATGAAAACAGCACCTGCTGGATACGCGTCAGCTACC
CGTGGGCGGGCAAAGGCTTCGGGATGATCCAGATCCCGCGTATCGGCCAGGAAGTGCTGGTGGATTTCAA
AAACGGCGATCCGGATCTGCCGATCATCGTGGGGCGTACCTACAACCAGGACACCATGCCGCCGTGGGGA
CTGCCGGGAATGGCGTCGCAGAGCGGGATCTTCAGCCACTCGCTGTATGGCGGGCCAACGAACGGCAACA
TGCTGCGTTTTGACGACAAAACGGGCGCGGAGGAAGTGAAGTTCCACGCGGAAAAAGATCTCAACACCAC
GGTGAAGAATAATGAAACGCATACGGTTATGGTGGATCGCACTAAAACCATTATTAAAAATGAAACCAAC
AGTATTGGTGAGGACAGAAACACCACGGTAACGAAGAATGACGGCCTTTCCGTAAAACTGGCGCAGACGA
TCAATATCGGCACCACTTATCGTTTAGATGTTGGCGATCAATTCACGCTTCGCTGCGGCAATGCGGCGCT
TGTTTTACATAAGGACGGCTCCATTGAGTTTTGTGGCAAGCAACTGATGTTACATACCAGCGATGTCATG
CAACTGATTGGTAAAGGTATTGATATGAACCCGGATGGCGGCACAGCCGTAACCGCCGATGATATTGCCC
CCCTTCTCACCTCTGAGTGA
 Primer design