SecReT6
Protein ID: 378711749
SecReT6 ID555
T6SS typei2
Gene symbol-
Locus tagEKO11_0940
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_016902] [Browse all T6SS(s) in this replicon]
Location [Strand]982954..986343 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDE8Y7B6
KEGG IDekf:KO11_08815, eko:EKO11_0940
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.30E-66, Aligned region: 412..729
IcmF-related [PF06761], Evalue: 3.30E-66, Aligned region: 792..833
DUF1215 [PF06744], Evalue: 1.30E-35, Aligned region: 446..479
DUF1215 [PF06744], Evalue: 1.30E-35, Aligned region: 852..971
Protein Sequence: 1129 a.a.     [Download]
>gi|378711749|ref|YP_005276642.1| ImcF domain-containing protein [Escherichia coli KO11FL]
MVPGLNRLRPRSVSGPAIVMTVAVVVALCTFIHRKPALLGVEPGSSQQMYWMAGVIAAGVVFLIIMGVYH
LLNRHAAVQNFELRRQLAAGDDYRAVTTKKADSRHPAMVELAAFLRDRYGPFWRRNVRLLLVTGEPEQAE
AIAPGLTGQHWLEGDHTVLIYGGRPSAEPDVTLLTALKKLRRSRPLDGIIWALTEEQSRQTAQLDKGWRE
LINGGKRLGFQAPLYLWQVCDNGDYQAGRPLQSVGCLLPERCTPEQLTAMLEAHTLPLTEQGMSQLLADN
RHDFLLRLAHTLAERGIAHWQSVLKPLLAGGAFSSLRLRGLMFSPPLTAVPEAAPHAWLPSQVWAGVTGD
NARGRAVGFPWLRAALMSAVCVLAIWGAGMTTSFFANCALVQETSIQTARALDTRLPQAEQLVALHTLQG
ELERLQYRIREGAPWYQRFGLERNQQLLAAAFPGYAQAANRLVRDVAVDHLQQQLNAFVALPPNSPQRTA
TGEQRYKQLKALLMTSRPEKADAAFFSTTLMADSLRYENIPEGVRQSVFPSLLTFWMANLPEHPQWKTSP
PPELTGAVRKILLRQIGVRNAENTLYQNVLQQVSRNYADMTLADMTGDTLTESLFSTEQTVPGMFTRQAW
EGQVREAIEQVVTARREEIDWVLSDRQQDTSADISPDTLRNRLTSRYFTDFTGSWLAFLNSIRWKKEDSL
SGILDQLTLMADARQSPLIALTDTLAWQAAAVRENRGLSDSLAKSAQELFNGKEKTPQQSREVDVPVGPL
DKTFAPLLRLLGDKAGGGGGDTQLSLQTYLTRVTRVRLKLQQVTNAPDPQEMTQQLAQTVLQGKTVDLTD
TRDYGRLIAASLGEEWSGFGQALFVRPVEQSWRQVLTPAADSLNRQWQRAIVSHWNQDFAGRYPFKASQN
DASLPLLAQYLRDDGRINQFIAANLSGVLKREGRYWVADAMNTQGLTVNPDFIRALNRLRDVADTAFASG
DAGIHFELRAKPARDVMKTHLVIDGQELEYFNQKERWQRFNWPDEQWQPGASLSWTSTQAMERILADYRG
SWSLIRLLEQAQVTPVDSSTFKVVWKAQDGLPLNYLLRVEQGKGPLALLELKNFRLPGQVFLTGRSMKDA
EEYGEDADE
 
Nucleotide Sequence: 3390 bp     [Download]
>gi|378710836|ref|NC_016902.1|:c986343-982954 Escherichia coli KO11FL chromosome, complete genome
GTGGTTCCGGGATTAAACCGTCTCCGGCCCCGTTCTGTTTCAGGGCCTGCCATCGTCATGACCGTGGCTG
TTGTGGTTGCGCTTTGCACGTTTATTCACCGTAAACCGGCATTGCTGGGCGTTGAACCGGGTAGCTCACA
GCAAATGTACTGGATGGCTGGCGTGATTGCCGCAGGCGTGGTCTTTTTGATTATCATGGGGGTTTATCAT
CTGCTGAACCGCCACGCTGCCGTACAAAACTTTGAACTCCGCAGACAACTTGCCGCCGGAGATGACTATC
GTGCGGTGACGACAAAGAAAGCCGACAGCCGTCATCCGGCAATGGTGGAACTCGCCGCCTTCCTGCGCGA
CCGCTACGGTCCGTTCTGGCGGCGTAACGTCCGCCTGCTGCTGGTGACCGGCGAGCCTGAACAGGCAGAA
GCCATCGCGCCGGGGCTGACCGGGCAACACTGGCTGGAGGGCGACCACACGGTGCTGATATATGGCGGCA
GGCCATCAGCGGAGCCTGATGTCACACTGCTGACCGCCTTAAAAAAACTGCGCCGCAGCCGTCCGCTGGA
CGGCATCATCTGGGCGCTGACAGAAGAACAGAGCCGCCAGACAGCGCAACTCGACAAAGGCTGGCGCGAA
CTGATAAACGGCGGTAAGCGACTCGGTTTTCAGGCCCCACTCTATTTGTGGCAGGTCTGTGACAACGGTG
ATTATCAGGCCGGACGCCCCCTGCAAAGCGTCGGCTGCCTGCTGCCGGAACGCTGCACCCCGGAACAACT
GACCGCCATGCTGGAAGCTCACACCCTGCCGCTGACGGAACAGGGCATGTCGCAACTGCTGGCTGATAAC
CGCCATGATTTTCTGCTGCGTCTGGCCCATACCCTTGCAGAGCGGGGTATCGCTCACTGGCAAAGCGTCC
TGAAACCGCTGCTGGCAGGCGGCGCATTCTCTTCCCTGCGCCTGCGTGGTCTGATGTTCAGCCCGCCGCT
TACCGCCGTACCGGAGGCCGCACCTCATGCGTGGCTGCCGTCACAGGTCTGGGCGGGCGTGACCGGCGAT
AACGCACGGGGGCGTGCAGTGGGCTTTCCGTGGCTACGCGCCGCGCTGATGTCCGCTGTCTGCGTGCTGG
CAATATGGGGGGCCGGAATGACGACCTCTTTCTTCGCCAACTGCGCTCTTGTTCAGGAAACCAGCATCCA
GACTGCACGTGCGCTTGATACCCGCCTGCCGCAGGCAGAACAACTGGTGGCGCTGCATACCCTGCAGGGC
GAACTGGAGCGCCTGCAATATCGTATCCGCGAAGGTGCGCCGTGGTATCAGCGTTTTGGCCTTGAACGTA
ACCAACAACTGCTCGCAGCCGCCTTTCCCGGCTATGCGCAGGCGGCAAACCGGCTGGTGCGCGACGTGGC
CGTTGACCATCTGCAACAGCAACTGAACGCCTTTGTCGCCCTGCCGCCCAACAGTCCTCAGCGTACCGCC
ACCGGTGAACAACGCTATAAGCAGCTTAAGGCATTGCTGATGACTTCCCGCCCGGAAAAGGCCGACGCTG
CCTTTTTCAGTACCACGCTGATGGCAGACAGCCTGCGCTACGAGAATATCCCGGAAGGTGTGCGGCAGAG
CGTGTTTCCGTCACTGCTGACCTTCTGGATGGCGAACCTGCCGGAACACCCGCAGTGGAAAACCTCGCCG
CCACCGGAACTGACCGGCGCGGTGCGTAAAATCCTGCTGCGCCAGATTGGTGTGCGTAATGCCGAAAACA
CTCTCTACCAGAACGTACTGCAACAGGTGTCCCGCAACTACGCCGATATGACGCTGGCGGACATGACCGG
GGATACCCTCACCGAATCTCTTTTCAGTACGGAACAGACGGTGCCGGGGATGTTCACCCGTCAGGCGTGG
GAAGGACAGGTCAGGGAAGCCATCGAGCAGGTGGTGACGGCGCGGCGCGAGGAAATCGACTGGGTGCTCA
GCGACCGCCAGCAGGATACCTCTGCGGATATATCGCCGGATACGCTGCGTAACCGTCTCACCTCACGCTA
CTTTACCGACTTCACCGGAAGCTGGCTGGCGTTTCTCAACAGCATTCGCTGGAAAAAGGAAGACTCGCTC
TCCGGCATTCTCGACCAGCTGACACTGATGGCCGATGCCCGTCAGTCGCCGCTGATTGCGCTGACCGATA
CCCTCGCGTGGCAGGCGGCGGCAGTCAGGGAAAACCGTGGCCTGTCAGACTCGCTGGCGAAATCGGCACA
GGAACTGTTTAACGGCAAGGAGAAAACGCCGCAGCAATCCCGTGAAGTCGATGTGCCTGTCGGGCCGCTG
GATAAAACCTTTGCTCCGCTGCTGCGGTTGCTGGGCGATAAGGCCGGAGGCGGTGGTGGTGATACGCAAC
TCAGCCTGCAAACGTATCTGACCCGCGTCACCCGCGTACGCCTCAAACTGCAACAGGTGACCAACGCCCC
CGACCCGCAGGAAATGACGCAACAGCTGGCACAGACGGTACTGCAGGGCAAAACCGTTGACCTCACCGAC
ACCCGCGACTACGGACGGTTAATCGCCGCCAGTCTGGGCGAGGAATGGAGTGGCTTCGGTCAGGCGCTGT
TCGTCCGCCCGGTGGAGCAGTCGTGGCGGCAGGTGCTGACGCCTGCGGCGGACAGCCTGAACCGCCAGTG
GCAGCGGGCGATTGTCAGCCACTGGAATCAGGACTTCGCTGGTCGCTACCCGTTCAAAGCCTCACAGAAC
GATGCCTCCCTCCCCCTGCTGGCGCAGTATCTGCGCGATGACGGGCGCATCAACCAGTTTATTGCCGCCA
ACCTTTCCGGCGTTCTGAAACGTGAAGGCCGCTACTGGGTGGCGGACGCCATGAACACGCAGGGGCTGAC
GGTCAACCCGGACTTTATCCGCGCCCTGAACCGCCTGCGCGACGTGGCTGACACCGCCTTTGCCAGCGGC
GATGCCGGAATACATTTTGAACTGCGGGCAAAACCGGCCCGAGACGTGATGAAGACACATCTGGTGATTG
ACGGGCAGGAACTGGAGTATTTCAACCAGAAAGAACGCTGGCAGCGTTTCAACTGGCCGGATGAACAGTG
GCAACCCGGCGCATCGCTGAGCTGGACCAGTACGCAGGCGATGGAACGCATACTGGCGGATTACCGGGGG
AGCTGGAGCCTTATTCGCCTGCTGGAACAGGCGCAGGTGACACCGGTGGACAGCAGCACCTTTAAAGTGG
TGTGGAAAGCGCAGGACGGCCTGCCGCTGAATTACCTGCTGCGGGTTGAACAGGGTAAAGGGCCGCTGGC
GCTGCTGGAACTGAAAAACTTCCGCCTGCCGGGACAGGTATTTCTGACCGGCAGGAGTATGAAAGATGCG
GAAGAATACGGGGAAGACGCCGATGAGTGA
 Primer design