SecReT6
Protein ID: 378714446
SecReT6 ID556
T6SS typei1
Gene symbol-
Locus tagEKO11_3702
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_016902] [Browse all T6SS(s) in this replicon]
Location [Strand]3866111..3869635 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDE8YBS0
KEGG IDeko:EKO11_3702
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 6.30E-84, Aligned region: 323..364
IcmF-related [PF06761], Evalue: 6.30E-84, Aligned region: 505..818
ImcF-related_N [PF14331], Evalue: 2.50E-62, Aligned region: 205..455
DUF1215 [PF06744], Evalue: 4.00E-34, Aligned region: 304..322
DUF1215 [PF06744], Evalue: 4.00E-34, Aligned region: 914..1033
AAA_22 [PF13401], Evalue: 9.50E-05, Aligned region: 140..273
AAA_22 [PF13401], Evalue: 9.50E-05, Aligned region: 856..887
Protein Sequence: 1174 a.a.     [Download]
>gi|378714446|ref|YP_005279339.1| type VI secretion protein IcmF [Escherichia coli KO11FL]
MFRLPTPRLLSGLKSALRPAMPRFKVSAFWLLILAWIFLLVWIWWKGPMWTLYEEQWLKPLANRWLATAA
WGIIALVWLTVRVMKRLQQLEKMQKQQREEAVDPLSVELNAQQRYLDRWLLRLQRHLDNRRFLWQLPWYM
VIGPAGSGKTTLLREGFPSDIIYAPEGARGAEQRLYLTPHVGKQAVIFDIDGTLCAPADADILHRRLWEH
ALGWLKEKRARQPLNGIILTLDLPDLLTADKRRREHLLQTLRSRLQDIRQHLHCQLPVYVVLTRLDLLQG
FAALFQSLNRQDRDAILGVTFTRRAHENDDWRTELNAFWQTWVDRMNLALPDLMVAQTHTRASLFSFSRQ
MQGSREPLVSLLEGLLDGENMNVMLRGVYLTSSLQRGQMDDIFTQSAARQYRLGNNPLASWPLVDTAPYF
TRSLFPQALLAEPNLATESRAWLIRSRRRLTVFSATGGVAALLLITGWHHYYNGNYQSGITVLKQAKAFM
DVPPPQGEDDFGNLQLPLLNPVRDATLAYGDWGDRSRLADMGLYQGRRIGPYVEQTYLQLLEQRYLPSLF
NGLVKAMNAAPPESEEKLAVLRVMRMLEDKSGRNNEVVKQYMAKRWSEKFHGQRDIQAQLMSHLDYALAH
TDWHAERQAGDGDAISRWTPYDKPVVSAQKELSKLPVYQRVYQSLKTRALGVLPADLNLRDQVGPTFDQV
FTSADDNKLVVPQFLTRYGLQSYFVKQRDELVELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYISDY
TATWRAGMDNLNIRNFESIGQLTGALEQVISGDLPLQRALTVLRDNTQPGVFSEKLSAKEREEALAEPDY
QLLTRLGHEFAPENSTLAVQKDKESTMQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQLRLDQNSSDPI
FATRQMAKTLPAPLNRWVGRLADQAWHVVMVEAVHYMEVDWRDSVVKPFNEQLANNYPFNPRSAQDASLD
AFERFFKPDGILDTFYQQNLKLFIDNDLSLEDGDNNVIIREDIIAQLETAQKIRDIFFSKQNGLGTSFAV
ETVSLSGNKRRSVLNLDGQLVDYSQGRNYTAHLVWPNNMREGNESKLTLIGTSGNAPRSISFSGPWAQFR
LFGAGQLTGVQDGNFTVRFSVDGGAMTYRVHTDTEDNPFSGGLFSQFGLSDTLY
 
Nucleotide Sequence: 3525 bp     [Download]
>gi|378710836|ref|NC_016902.1|:3866111-3869635 Escherichia coli KO11FL chromosome, complete genome
GTGTTCAGATTACCAACACCCCGACTACTCAGCGGACTCAAATCAGCCCTGCGACCGGCGATGCCCCGGT
TTAAAGTCTCTGCTTTCTGGCTGCTGATACTGGCGTGGATTTTTCTGCTGGTGTGGATCTGGTGGAAAGG
CCCGATGTGGACGCTGTATGAAGAACAGTGGCTCAAACCACTGGCGAACCGCTGGCTGGCAACGGCGGCG
TGGGGGATTATTGCCCTGGTGTGGCTTACCGTCCGGGTGATGAAGCGCCTGCAACAGCTTGAAAAAATGC
AAAAGCAACAGCGCGAGGAAGCCGTTGATCCGCTCAGCGTGGAACTGAACGCCCAGCAGCGTTATCTTGA
CCGCTGGCTGCTGCGCCTGCAACGCCATCTCGACAACCGCCGTTTCCTGTGGCAGTTGCCGTGGTATATG
GTCATCGGCCCGGCGGGCAGTGGCAAAACGACACTGCTGCGCGAGGGGTTTCCGTCCGACATTATTTATG
CCCCGGAGGGCGCACGCGGCGCAGAACAACGCCTGTACCTCACGCCCCATGTCGGTAAACAGGCGGTGAT
CTTTGATATCGACGGCACACTCTGCGCTCCCGCTGATGCGGATATCCTGCATCGCCGTCTGTGGGAACAT
GCCCTCGGCTGGCTGAAAGAAAAGCGCGCGCGCCAGCCGCTGAACGGGATTATTCTGACACTCGATTTAC
CCGATCTGCTTACCGCAGACAAACGCCGCCGCGAGCATCTGTTACAGACGCTGCGCAGCCGCTTACAGGA
TATACGCCAGCATCTTCACTGCCAGTTACCGGTTTACGTGGTACTGACCCGGCTTGATTTATTACAGGGT
TTTGCCGCCCTGTTCCAGTCACTCAACAGACAGGATCGCGATGCGATTCTGGGCGTCACGTTCACCCGCC
GTGCCCATGAAAATGATGACTGGCGAACAGAGTTGAATGCTTTCTGGCAGACATGGGTGGATCGAATGAA
TCTGGCGTTGCCGGATCTGATGGTCGCTCAGACTCACACCCGCGCGTCTTTATTCAGTTTTTCCCGCCAG
ATGCAGGGAAGCCGTGAACCGCTGGTGTCACTGCTTGAGGGTCTGCTTGATGGCGAAAATATGAACGTGA
TGCTGCGTGGTGTCTATCTCACCTCTTCGCTTCAGCGTGGACAGATGGATGATATATTCACCCAGTCTGC
CGCCCGCCAGTACCGGCTGGGCAATAACCCACTGGCGTCCTGGCCCCTGGTGGACACCGCGCCTTATTTC
ACCCGCAGCCTGTTCCCGCAGGCATTACTCGCAGAGCCTAATCTGGCAACAGAGAGCCGCGCCTGGCTGA
TACGTTCCCGTCGCCGCCTGACGGTTTTCTCTGCCACAGGCGGCGTGGCAGCACTGCTGCTCATCACCGG
CTGGCATCACTATTACAACGGTAACTATCAGTCCGGCATCACCGTGCTTAAGCAGGCCAAAGCCTTTATG
GACGTGCCGCCTCCGCAGGGGGAAGATGACTTTGGCAACCTGCAACTGCCGCTCCTGAACCCGGTACGCG
ATGCCACACTGGCCTATGGCGACTGGGGCGACCGCAGCCGTCTGGCCGATATGGGACTGTACCAGGGACG
ACGTATCGGGCCTTATGTGGAACAGACCTATCTGCAACTGCTGGAGCAACGTTACCTGCCCTCGCTGTTT
AACGGGCTGGTCAAAGCGATGAACGCCGCGCCGCCGGAGAGTGAAGAAAAACTCGCGGTGCTGCGCGTAA
TGCGAATGCTGGAGGACAAAAGCGGACGTAACAATGAGGTGGTGAAGCAGTATATGGCAAAACGCTGGAG
CGAAAAATTCCACGGCCAGCGCGATATCCAGGCACAACTGATGTCCCATCTTGACTACGCGCTGGCTCAT
ACTGACTGGCATGCAGAGCGTCAGGCGGGCGACGGTGACGCCATCAGCCGCTGGACGCCATATGACAAGC
CCGTGGTATCAGCACAGAAAGAACTGAGCAAACTGCCTGTCTACCAGCGGGTTTACCAGAGCCTGAAAAC
GCGGGCGCTGGGCGTTCTTCCTGCCGACCTCAATCTGCGTGACCAGGTAGGGCCAACCTTTGACCAGGTG
TTTACATCTGCCGATGACAACAAACTGGTTGTTCCACAGTTTCTTACCCGTTACGGCCTGCAAAGCTATT
TTGTAAAACAGCGCGATGAACTGGTTGAACTGACGGCGATGGATTCCTGGGTACTTAACCTTACCCGCAG
CGTGAAATACAGTGACGCCGACCGTGCGGAAATCCAGCGCCAGTTGACCGAGCAGTATATCAGCGACTAC
ACCGCCACCTGGCGGGCCGGGATGGACAATCTGAATATCCGCAATTTTGAGTCCATCGGACAACTGACCG
GGGCGCTGGAGCAGGTTATCAGCGGCGACCTGCCTTTGCAGCGGGCGCTAACCGTGCTGCGTGACAACAC
ACAGCCAGGCGTCTTTTCTGAAAAACTCTCTGCCAAAGAACGGGAGGAAGCCCTGGCAGAGCCGGATTAC
CAGTTACTCACCCGCCTCGGGCATGAATTCGCCCCGGAAAACAGTACCCTGGCAGTACAGAAAGACAAAG
AAAGCACGATGCAGGCCGTGTATCAGCAACTCACCGAGTTGCACCGCTACCTGCTGGCAATCCAGAACGC
GCCTGTACCAGGGAAATCGGCGCTGAAAGCCGTGCAGTTACGGCTTGATCAGAACAGCAGCGATCCGATA
TTCGCCACCCGCCAGATGGCAAAAACGCTGCCTGCTCCGCTCAACCGCTGGGTTGGCAGGCTGGCTGACC
AGGCCTGGCATGTGGTGATGGTGGAGGCTGTTCATTATATGGAAGTGGACTGGCGCGACAGCGTGGTGAA
ACCGTTTAACGAGCAACTGGCAAATAACTATCCGTTTAATCCGCGTTCTGCACAGGATGCCTCACTGGAT
GCCTTCGAACGCTTCTTTAAACCGGATGGCATACTGGATACCTTCTACCAGCAGAACCTGAAGCTGTTTA
TCGATAATGACCTGAGTCTGGAGGATGGCGATAACAACGTCATTATTCGCGAAGATATTATTGCGCAACT
GGAAACTGCGCAGAAAATCCGTGACATCTTCTTCAGCAAACAGAACGGTCTGGGAACATCCTTTGCCGTG
GAAACGGTATCGCTTTCAGGCAATAAACGCCGCAGTGTACTGAACCTTGACGGTCAGTTAGTCGATTACA
GCCAGGGCCGTAACTATACCGCCCATCTGGTCTGGCCTAACAACATGCGCGAAGGCAACGAAAGTAAGCT
GACGCTCATCGGCACCAGCGGCAACGCGCCGCGCAGTATCAGCTTCAGCGGGCCGTGGGCGCAGTTCCGC
CTGTTCGGGGCCGGACAACTGACCGGAGTACAGGATGGCAACTTTACCGTGCGCTTTAGCGTGGACGGTG
GCGCGATGACCTACCGTGTGCATACCGACACGGAAGATAACCCGTTCAGCGGTGGGTTGTTCAGCCAGTT
TGGTCTGTCAGACACACTGTACTGA
 Primer design