SecReT6
Protein ID: 378766692
SecReT6 ID536
T6SS typei3
Gene symbolicmF1
Locus tagPANA5342_1725
StrainPantoea ananatis LMG 5342
Repliconchromosome [GenBank: NC_016816] [Browse all T6SS(s) in this replicon]
Location [Strand]1823127..1826753 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDG9AQS7
KEGG IDplf:PANA5342_1725
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.00E-97, Aligned region: 208..486
IcmF-related [PF06761], Evalue: 4.80E-85, Aligned region: 535..841
DUF1215 [PF06744], Evalue: 7.60E-31, Aligned region: 861..888
DUF1215 [PF06744], Evalue: 7.60E-31, Aligned region: 950..1075
Protein Sequence: 1208 a.a.     [Download]
>gi|378766692|ref|YP_005195155.1| type VI secretion protein IcmF [Pantoea ananatis LMG 5342]
MLNVLFAVLTSRLAWGFVGITALSFIIWVIGPVFSIVDSRPLESEQNRVISIALLYVVWGLSQAIPRVYN
YWLNRKLMSSLETSKSDTPEEDRKRLTSEDQVLASRFSEATEMLKKAHFQRQSSKGAPFWAQRFSHQYLY
QLPWYMIIGAPGAGKTTALVNSGLQFPLADKFGKAALRGIGGTRNCDWWFTNEAVLLDTAGRYTTQESQQ
ERDAGEWHQFLDLLRKYRGRQPVNGVIVTLSVADLLSQSPEAMRNQAVALRQRLMELHDRLGIRFPVYVL
VTKTDLLKGFRSYFASLDKAQREQIWGFTFPWAKASTAEFELSSQFQQEYSLLQQRLDAGLADVLLAESD
AQARAESYLFPQEFAALRPQLAEALDILFARSDFETQFAPRGIYFASGTQEGLPFDRVMGELTRALHLPG
QQQSESGSWDKVDKDAPIPQNKGQSFFLKGVLENVIFQESGLAGSNRWWELRNRVGLWSGYLALLVIVLI
AGALWLVSYNKNKTYLQEMAAKSPQVEQLGDKLQKEVNGNLFALVPYLNTLLHLPESASFSLEHPPLTRR
MGLYRGTEVSDATQALYERALKQLLMPQVAQNITRWLRNDTGSDADYSYEALKAYQMLYQPKHYDGKFLQ
AWMMLNISRELPQDVTQAEVKQLAWHLQQLLETQIQSSPYAKDDALVKREQALISQMPLSQRVYGRLKRL
LERDGSMSQVTLSALGGPQSELVFSRKSGKSVNEGVSGLFTPDGYWNHVDKQIAPVTDALYKDDIWVLGA
ETAHEDGKQTDLAVRQLYIQDYIRQWEQFLSDIQLNSSADLTQRINTARLLSGNHSPLRQLVINLSKQLT
LTRAQPEDKNAKDTAASSDNSATRTLQALFTSPRANGEQAVVQQTPEQAVTAHFAPVIELAQPLQQGSKV
LAVDDFLKQIDDLYRYLTAVQDAANSGMPPPASDAISRLQASAGRLPGSLQNMVSGMAVGASSDAQRRDM
DNVRKRITMEVGSFCRQAIAGRYPLVRNARSEVTPDDLARMFAPGTGLMDSFFRDNLASKVDTTRAAWRF
TPGIDGKTLPGGEALLRPFQQAQSIRDAFFANGATTPSFRVTLRTVKMDNDILNMTLDVDGQILRYSHGP
QAVQLVSWPGPGGTSQVRMQLGLTNGTTSTLTTSGPWALNRFFDRARVTSVGGLTREASFSVDGHNVTLS
FTPGSIRNPFQLPAFSCP
 
Nucleotide Sequence: 3627 bp     [Download]
>gi|378764971|ref|NC_016816.1|:1823127-1826753 Pantoea ananatis LMG 5342, complete genome
ATGCTGAATGTACTATTTGCGGTACTGACCAGCCGTCTGGCCTGGGGCTTTGTCGGTATCACCGCACTTT
CGTTTATTATCTGGGTCATTGGCCCGGTGTTCTCGATTGTGGACTCCCGTCCGTTGGAGTCAGAACAGAA
CCGCGTAATCAGTATTGCGCTGCTCTATGTTGTCTGGGGCCTGAGCCAGGCGATTCCGCGTGTCTATAAC
TACTGGCTCAACCGTAAGCTGATGTCCAGCCTGGAAACCAGCAAATCGGATACGCCGGAAGAAGACCGCA
AGCGACTGACCAGTGAAGATCAGGTGCTGGCCAGCCGCTTCTCTGAAGCGACTGAGATGCTGAAAAAAGC
ACACTTCCAGCGGCAGAGCAGCAAAGGTGCGCCTTTCTGGGCGCAGCGCTTCAGTCATCAATATCTCTAT
CAACTGCCTTGGTACATGATCATCGGCGCGCCAGGTGCCGGTAAAACCACCGCTCTGGTGAATTCTGGCT
TGCAGTTCCCACTGGCGGACAAGTTCGGTAAGGCTGCGCTACGTGGGATCGGCGGGACGCGTAACTGTGA
CTGGTGGTTTACTAACGAAGCCGTGCTGCTGGATACGGCGGGGCGCTATACCACGCAGGAGAGCCAGCAG
GAGCGCGATGCCGGCGAATGGCATCAGTTTCTCGACCTCCTGCGTAAATACCGTGGCCGTCAGCCGGTTA
ACGGCGTCATCGTCACCTTGAGCGTGGCAGACCTGTTATCACAGTCGCCCGAGGCCATGCGCAATCAGGC
CGTGGCGCTGCGCCAGCGTCTGATGGAGTTACACGATCGGCTCGGTATTCGCTTTCCGGTGTATGTCCTG
GTCACCAAAACCGACCTGTTAAAGGGGTTCCGCAGCTATTTTGCCAGCCTGGATAAGGCACAGCGCGAGC
AGATTTGGGGTTTTACCTTTCCGTGGGCCAAAGCATCAACGGCTGAATTTGAACTCAGCAGCCAGTTTCA
GCAGGAATATTCGCTGCTGCAGCAGCGCCTGGATGCCGGACTGGCCGATGTACTGCTGGCGGAAAGTGAT
GCCCAGGCACGTGCCGAAAGCTACCTGTTTCCACAGGAGTTTGCGGCATTGCGCCCTCAGTTGGCTGAGG
CGCTGGATATTCTGTTTGCGCGTTCCGATTTCGAAACGCAGTTCGCCCCGCGCGGCATCTACTTTGCCAG
CGGTACGCAGGAAGGCTTACCCTTTGACCGCGTAATGGGTGAACTCACGCGCGCCCTGCATCTGCCAGGC
CAGCAGCAGAGTGAGTCGGGCAGTTGGGACAAAGTGGATAAAGACGCGCCGATCCCTCAAAACAAAGGGC
AGAGCTTTTTCCTTAAGGGCGTGCTGGAAAATGTCATCTTCCAGGAGTCCGGTCTGGCCGGCAGTAACCG
CTGGTGGGAGCTACGTAACCGCGTGGGCCTGTGGTCGGGTTATCTGGCGTTACTGGTTATCGTACTCATT
GCCGGTGCACTGTGGCTGGTGAGCTATAACAAAAACAAAACCTACCTGCAGGAGATGGCGGCGAAAAGCC
CCCAGGTCGAGCAGCTCGGTGACAAGTTACAAAAAGAGGTGAACGGCAACCTCTTTGCACTGGTGCCTTA
CCTCAATACGCTGCTGCACCTGCCTGAAAGCGCCTCCTTTTCTCTGGAGCATCCGCCGCTCACGCGCCGG
ATGGGGCTGTATCGCGGAACGGAAGTCAGTGATGCGACCCAGGCCTTGTACGAAAGGGCGCTGAAACAGC
TGCTGATGCCGCAGGTTGCGCAGAATATCACCCGCTGGTTACGCAATGATACGGGAAGTGACGCTGACTA
CAGCTATGAGGCGCTTAAGGCTTATCAGATGCTGTACCAGCCAAAACACTATGACGGTAAGTTTCTTCAG
GCGTGGATGATGTTAAACATCTCACGTGAATTGCCGCAGGACGTGACTCAGGCTGAGGTGAAACAGCTGG
CGTGGCACCTGCAACAGCTACTGGAAACGCAGATTCAGTCCTCGCCCTATGCGAAGGATGATGCGCTGGT
AAAGCGCGAGCAGGCGCTGATTAGTCAGATGCCGCTGTCACAGCGCGTTTACGGACGCCTGAAACGCCTG
CTGGAACGCGATGGCTCAATGTCACAGGTTACCTTGTCCGCGCTGGGTGGACCGCAAAGTGAACTGGTGT
TTTCCCGTAAAAGCGGTAAGTCTGTCAATGAAGGTGTTTCCGGGCTCTTTACGCCAGACGGCTACTGGAA
CCATGTGGATAAACAGATCGCGCCGGTCACGGATGCGCTCTACAAAGACGATATCTGGGTGCTGGGTGCA
GAGACGGCCCATGAAGACGGCAAACAAACCGACCTTGCGGTGCGCCAGCTCTATATTCAGGATTACATCC
GCCAGTGGGAGCAGTTTCTCAGCGATATTCAACTCAACAGCAGCGCCGATTTGACCCAACGTATTAATAC
GGCGCGCCTGCTGTCAGGGAATCATTCGCCGCTGCGGCAGTTAGTGATTAACCTGAGCAAACAGCTCACG
CTCACCCGGGCGCAGCCTGAAGACAAGAATGCCAAAGATACGGCCGCGTCATCGGATAACAGCGCCACAC
GAACGCTGCAGGCACTGTTTACCTCGCCGCGCGCAAACGGCGAGCAGGCGGTGGTGCAGCAAACGCCCGA
GCAGGCGGTGACCGCGCACTTTGCACCTGTCATCGAGCTGGCACAGCCGTTACAGCAGGGCAGTAAGGTC
CTGGCCGTTGATGATTTTCTTAAGCAGATCGACGATCTCTATCGCTATCTCACTGCCGTGCAGGATGCCG
CGAATAGCGGTATGCCACCGCCGGCGAGTGATGCCATTAGCCGTTTGCAGGCCAGCGCCGGACGTTTGCC
CGGTTCACTGCAAAATATGGTGTCAGGCATGGCAGTGGGCGCCAGCAGCGATGCACAGCGTCGCGACATG
GATAACGTTCGCAAGCGCATCACCATGGAAGTCGGCAGCTTCTGCCGTCAGGCGATAGCAGGCCGTTACC
CGCTGGTCCGGAATGCACGCAGCGAAGTCACGCCTGATGACCTGGCGCGCATGTTTGCGCCGGGAACCGG
ACTGATGGACAGCTTCTTCCGCGATAATCTGGCCAGCAAAGTGGATACCACGCGCGCGGCATGGCGCTTC
ACGCCCGGCATTGATGGCAAAACCTTGCCAGGTGGCGAAGCCTTGCTGCGTCCTTTCCAGCAGGCGCAGT
CGATTCGCGACGCCTTCTTTGCCAATGGGGCCACTACGCCATCCTTCCGCGTCACGTTACGGACGGTGAA
GATGGATAACGATATCCTGAATATGACGCTGGATGTCGATGGACAGATTTTGCGCTACAGTCATGGACCA
CAGGCAGTGCAGTTAGTGAGTTGGCCCGGACCAGGTGGAACCAGTCAGGTGCGCATGCAACTGGGGCTAA
CGAACGGCACGACCTCAACCCTGACCACCAGCGGCCCATGGGCGCTTAATCGCTTCTTTGATCGCGCACG
GGTGACGTCGGTAGGTGGACTGACTCGCGAAGCCAGCTTTAGTGTGGACGGCCATAATGTGACGCTGTCA
TTCACGCCAGGCAGCATTCGTAATCCTTTCCAGCTACCCGCATTTAGCTGTCCCTGA
 Primer design