SecReT6
Protein ID: 378950325
SecReT6 ID539
T6SS typei4a
Gene symbolvgrG
Locus tagPSF113_2409
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]2807673..2809682 [-]
Productprotein VgrG
NoteTssI
UniProt IDG8QBH1
KEGG IDpfe:PSF113_2409
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.00E-68, Aligned region: 44..324
Phage_base_V [PF04717], Evalue: 2.00E-22, Aligned region: 352..445
Gp5_C [PF06715], Evalue: 6.70E-11, Aligned region: 489..501
Gp5_C [PF06715], Evalue: 6.70E-11, Aligned region: 502..524
Gp5_C [PF06715], Evalue: 6.70E-11, Aligned region: 537..558
Gp5_C [PF06715], Evalue: 6.70E-11, Aligned region: 561..584
Gp5_C [PF06715], Evalue: 6.70E-11, Aligned region: 648..655
Protein Sequence: 669 a.a.     [Download]
>gi|378950325|ref|YP_005207813.1| protein VgrG [Pseudomonas fluorescens F113]
MPRSTDSNTTLSLTATSLSALYPESLSGEERLNALGSHILNGINDGASLDLTTAVASHVTTTLHKDALLR
PLDWLVAEIRQLPADATAERYQLLLRPWLWWLSLASNNRVFQNLATSDIVTTIFKGHGFTDFQLKLSGSY
TPREYCVQYGETDLAFVSRLMEEDGIFWFFTHEAGTHTLLLADSNDAFAPIPNGPTVNYLGQKMGERELH
GIRSGQVCLQAVAGVYQATDYAFTTPTTSLYSQAEAVAGPSSVYEHPGSYTAKAQGDALTKQRVDGLRSQ
EKRFVGESDCRWLVPGYWFTLAGHEDSTLNIDWVVTAVSHEASHDSYRNRFEAIPKATVYRPARLTPKPR
MHTQTALVVGKAGEEIWTDEYGRIKLQFPWDRTGKNDETSSCWVRVVLPWSGKGFGMQFVPRIGQEVIVT
FIDGDPDRPLVTGCVYNGDNALPYALPANQTQSGIKTNSSKGGGGFNELRFEDKKDAEEVFLQAQKDFNI
NVLNDTTATVGHDETLTVQNARTRTVKDGDETVTLEKGKRSVAIQTGSDSLDVKDTRTVTVGSDQNHSTG
GNYDHKVTGNYSLTVDGNLTIKVSGTLTLQSGGSFAIKSGADLAAQASTSISQKAGTALSNQAGTSLENK
AGTTLTNDAGISLVNKAAAEQTVDGGGMLTIKGGLVKVN
 
Nucleotide Sequence: 2010 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c2809682-2807673 Pseudomonas fluorescens F113 chromosome, complete genome
ATGCCCCGCTCCACCGACAGCAACACCACGCTATCACTCACCGCCACCTCGCTGTCGGCGCTGTACCCTG
AATCGCTGTCCGGCGAAGAACGCCTCAACGCCCTGGGTTCGCACATCCTCAACGGCATCAACGACGGCGC
CTCGCTGGACCTCACGACAGCCGTCGCCAGCCACGTGACCACCACGCTGCACAAGGACGCCTTGCTGCGT
CCGCTGGACTGGCTGGTGGCCGAGATCCGCCAGCTTCCTGCCGACGCCACCGCCGAGCGCTATCAGCTTT
TACTCCGGCCCTGGCTCTGGTGGCTGAGCCTGGCCAGCAACAACCGTGTGTTCCAGAACCTTGCCACCTC
GGACATCGTTACCACGATTTTCAAGGGCCACGGTTTCACCGACTTCCAGCTCAAGCTCAGCGGCAGCTAC
ACCCCGCGCGAGTACTGCGTGCAGTACGGCGAAACCGACCTGGCCTTCGTCTCGCGCCTGATGGAAGAGG
ACGGAATTTTCTGGTTCTTCACCCATGAAGCAGGCACGCACACCCTGTTACTGGCCGACAGCAACGATGC
CTTCGCGCCCATCCCCAACGGGCCGACGGTGAATTATCTCGGGCAGAAAATGGGTGAGCGTGAACTGCAC
GGTATCCGTTCGGGGCAAGTGTGCCTGCAAGCGGTGGCCGGGGTTTACCAGGCGACCGATTATGCGTTCA
CCACACCGACAACATCACTCTACAGCCAGGCCGAAGCCGTGGCCGGGCCAAGCTCGGTGTACGAACATCC
AGGCAGCTATACCGCCAAGGCCCAGGGCGATGCGCTGACCAAACAGCGGGTGGATGGCCTGCGCAGCCAG
GAGAAACGCTTCGTTGGCGAAAGCGACTGCCGCTGGCTGGTGCCAGGGTATTGGTTCACCCTCGCCGGCC
ATGAAGACTCGACGCTGAATATCGATTGGGTCGTGACGGCGGTCAGCCATGAAGCCAGTCACGACAGCTA
TCGCAACCGCTTCGAAGCGATCCCCAAGGCCACGGTCTATCGACCGGCCCGCCTCACGCCAAAACCCCGC
ATGCACACCCAGACGGCGCTGGTGGTGGGCAAGGCCGGCGAAGAAATCTGGACCGACGAATACGGCCGGA
TCAAATTGCAGTTCCCCTGGGACCGTACCGGCAAGAACGACGAGACCTCATCGTGCTGGGTCCGCGTGGT
CTTGCCCTGGAGCGGCAAAGGCTTTGGCATGCAGTTCGTGCCGCGCATCGGCCAGGAAGTCATCGTGACC
TTCATCGACGGCGACCCGGACCGTCCCTTGGTCACCGGCTGCGTCTACAACGGCGACAACGCCCTGCCCT
ATGCGCTGCCGGCGAACCAGACCCAGTCCGGGATCAAGACCAATTCGTCCAAGGGCGGTGGTGGTTTCAA
CGAGTTGCGCTTCGAAGACAAGAAGGACGCCGAAGAGGTGTTTCTCCAGGCTCAGAAAGACTTCAACATC
AACGTGCTCAACGACACCACCGCCACCGTCGGCCACGACGAAACCCTCACGGTGCAGAACGCCCGCACCC
GCACGGTAAAGGACGGCGACGAAACCGTGACCCTGGAGAAAGGCAAGCGCAGCGTGGCCATCCAGACCGG
CAGCGACAGCCTCGATGTGAAGGACACCCGCACCGTCACCGTGGGCTCGGACCAGAACCACAGCACCGGC
GGCAACTATGACCACAAGGTCACCGGCAACTACAGCCTGACGGTGGACGGCAACCTGACCATCAAGGTCA
GCGGCACCCTGACCCTGCAAAGTGGCGGCAGCTTCGCGATCAAGAGCGGCGCAGACCTGGCCGCCCAGGC
CAGCACGTCCATCAGCCAGAAAGCCGGCACGGCCCTGAGCAATCAGGCCGGTACGTCGCTGGAAAACAAG
GCCGGTACCACCCTGACCAACGACGCCGGTATCAGCCTGGTAAACAAGGCGGCGGCCGAACAGACCGTGG
ACGGCGGCGGCATGCTGACCATCAAGGGCGGCCTGGTGAAGGTCAACTGA
 Primer design