SecReT6
Protein ID: 378950328
SecReT6 ID539
T6SS typei4a
Gene symbolimpH
Locus tagPSF113_2412
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]2812931..2813956 [-]
Productprotein ImpH
NoteTssG
UniProt IDG8QBH4
KEGG IDpfe:PSF113_2412
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.70E-81, Aligned region: 20..321
Protein Sequence: 341 a.a.     [Download]
>gi|378950328|ref|YP_005207816.1| protein ImpH [Pseudomonas fluorescens F113]
MATPSRQTPGALNLSERLRRDPQRFEWLQALLLLEREHPQAEPLGSGTAPHAEALRLRGPLTPLFAASEV
ESLRQEPGLPPTLTTPIFGLGGPDGPLPYAYQEWLQQRARAKDYAPAEFLDLFQHRLLSLLYKVMRKHRI
ALGFTAPGSSAVHAQLRALTGLLPKALQERQAVPDSAVLACTALYADGRRSLDGFAAIVREQFGLPVELN
AYEGGWREIPPASRSRLQPGGRNLRLGRNAVAGTHVWDEHAGVRLTLGPLTTGQASELLPNGETHPLLAS
LYALYFGPDLDCTLVLLIRGAGPLQLDRQAAPRLNWNGGLQRQPTLAVQRIETRLRQPEIA
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c2813956-2812931 Pseudomonas fluorescens F113 chromosome, complete genome
ATGGCAACCCCAAGCCGGCAAACCCCTGGTGCTCTGAACCTGAGCGAGCGACTGCGGCGCGACCCGCAAC
GCTTCGAATGGCTCCAGGCCCTGCTGTTGCTCGAACGTGAACACCCCCAGGCCGAGCCCCTGGGCAGCGG
CACCGCGCCGCACGCCGAAGCCTTGCGTCTGCGCGGGCCCTTGACGCCGCTGTTCGCCGCCAGCGAAGTG
GAAAGCCTGCGCCAGGAACCCGGCCTGCCGCCAACCCTGACTACGCCGATCTTCGGCCTTGGCGGCCCCG
ACGGCCCGTTGCCCTACGCCTATCAGGAATGGCTGCAACAACGGGCAAGGGCGAAGGACTATGCCCCGGC
GGAATTCCTCGACCTGTTCCAGCATCGCCTGCTCAGCCTGCTTTACAAGGTGATGCGCAAACATCGCATC
GCCTTGGGTTTCACTGCCCCGGGATCGTCCGCCGTACACGCGCAACTGCGGGCGTTGACCGGCCTGCTGC
CCAAAGCCTTGCAGGAGCGCCAGGCCGTCCCCGACTCGGCGGTACTGGCCTGCACCGCACTGTACGCCGA
TGGCCGGCGCTCCCTGGACGGGTTCGCGGCGATTGTCCGGGAACAGTTCGGGCTGCCCGTGGAGCTGAAC
GCCTACGAAGGTGGCTGGCGTGAAATCCCGCCGGCCAGCCGCAGCCGCTTGCAACCGGGCGGGCGCAACC
TGCGCCTGGGCCGCAACGCGGTGGCCGGTACACACGTCTGGGACGAACATGCTGGCGTGCGCCTGACCCT
CGGGCCGCTGACCACGGGCCAGGCCAGCGAACTGCTGCCCAACGGCGAAACCCATCCGCTGCTCGCCAGT
CTCTACGCCCTGTACTTCGGCCCCGATCTGGATTGCACCCTGGTACTGCTGATCCGTGGTGCCGGCCCAC
TGCAACTGGACCGCCAGGCAGCGCCACGGCTGAACTGGAACGGTGGCCTGCAACGCCAGCCAACCCTCGC
CGTGCAACGGATCGAAACCCGTCTTCGCCAGCCGGAGATTGCCTGA
 Primer design