SecReT6
Protein ID: 378950329
SecReT6 ID539
T6SS typei4a
Gene symbolimpG
Locus tagPSF113_2413
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]2813920..2815710 [-]
Productprotein ImpG
NoteTssF
UniProt IDG8QBH5
KEGG IDpfe:PSF113_2413
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.10E-179, Aligned region: 9..593
Protein Sequence: 596 a.a.     [Download]
>gi|378950329|ref|YP_005207817.1| protein ImpG [Pseudomonas fluorescens F113]
MSDSIDPHLLDYYQRELTWLRHAGSLFAERYPKVARRLELSPGECPDPHVERLLEGFALLAARLQRRLDD
DYAEFSDALLEQLYPLAMRPLPSCAIVQFEPDPSKGNLNEGYPLPRDTPLFVTTDKGQSIHFRTTAAVHL
WPVEISEALLLGSDEAQALTGVVRARSALRLELRCLGESQWSTLGIDSLRVHLAASPIINAGLYDLLGAH
AIEVLAGAPGSVPEPLKGLPQIVGFASDQVLLPDEDGVHPGMRLLAEYFAFPDKFGFFDLPLAGATSDGP
SLYLYIVFDRPPTSRLPLQASDIALGCTPVINLFPRTSEPLRPDGTRSEYRLVADSHRENSVEIHSIRGM
RAMSSQGVRKVPAYYGSQHGSNQTCYWHARRVSGMSPNRLGTDLMVSLVDTQFDPLADTRDYSLTAELLC
TNRHLAQSLPAGTPLGFERPGPVAWARLRNPPSPQSLPRLDGESRWRLVSQLTLNHLSLVEGPQALDALR
EILQLHNLRDEASAHRQIEGVSGLGCDRVIAHVGEDAWRGWRNGLEVRLQLDPQHFVGSSAVLFSGVLAQ
FFSLYATANRFVRTVLVQSDKEVKTWQPQAGKPLVL
 
Nucleotide Sequence: 1791 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c2815710-2813920 Pseudomonas fluorescens F113 chromosome, complete genome
ATGAGCGACTCGATTGACCCGCACCTGTTGGACTATTACCAACGCGAACTGACCTGGTTGCGGCATGCCG
GGAGTCTGTTCGCCGAGCGCTACCCCAAGGTCGCCCGGCGCCTGGAGTTGTCCCCCGGCGAGTGCCCCGA
CCCGCATGTCGAGCGCCTGCTCGAAGGTTTCGCGCTGTTGGCCGCCCGCTTGCAACGACGGCTGGACGAC
GACTATGCCGAGTTCAGCGATGCCCTGCTCGAACAGCTTTACCCGTTGGCCATGCGGCCCTTGCCGTCGT
GTGCCATCGTGCAGTTCGAACCCGACCCCAGCAAAGGCAACTTGAACGAGGGCTACCCGCTGCCCCGCGA
CACACCGTTGTTCGTCACCACGGACAAAGGCCAGAGCATTCATTTTCGGACCACCGCCGCCGTGCATTTG
TGGCCGGTGGAAATCAGCGAGGCATTGCTGCTGGGCAGCGACGAAGCCCAGGCGCTGACCGGAGTGGTCC
GGGCACGCTCGGCCTTGCGCCTGGAGCTGCGGTGCCTGGGCGAAAGCCAGTGGTCGACGCTGGGAATCGA
CTCGCTGCGGGTACACCTGGCGGCGTCACCGATCATCAACGCCGGGCTGTACGACCTGCTGGGCGCGCAC
GCCATCGAGGTCTTGGCCGGTGCGCCGGGCAGCGTGCCGGAGCCACTGAAGGGCTTGCCACAGATCGTCG
GCTTCGCCAGTGACCAGGTCCTGCTGCCAGACGAAGACGGTGTGCACCCCGGCATGCGCCTGCTGGCCGA
GTACTTTGCCTTCCCGGACAAATTCGGCTTCTTCGATCTGCCACTGGCCGGCGCCACCAGCGACGGTCCG
TCGTTGTACCTGTACATCGTTTTCGACCGCCCTCCCACCAGCCGCCTGCCGCTCCAGGCCAGCGACATCG
CCCTGGGCTGCACGCCGGTGATCAATCTGTTTCCCAGGACTTCCGAGCCGCTGCGCCCGGATGGCACCCG
CAGCGAGTACCGGTTGGTGGCCGACAGTCATCGGGAAAACAGCGTCGAGATCCACAGCATCCGTGGCATG
CGCGCCATGTCCAGCCAGGGCGTGCGCAAAGTGCCGGCCTATTACGGCAGCCAGCATGGCAGCAACCAAA
CCTGTTATTGGCATGCACGACGGGTCAGTGGAATGAGCCCGAACCGACTGGGCACCGACTTGATGGTCAG
CCTGGTGGACACCCAGTTCGACCCGCTGGCCGACACCCGCGACTACAGCCTCACCGCCGAACTGCTGTGC
ACCAACCGTCATCTGGCCCAGAGCCTGCCGGCCGGCACGCCGCTGGGTTTCGAACGTCCGGGGCCGGTGG
CCTGGGCACGCCTGCGCAACCCACCCAGCCCGCAAAGCCTGCCGCGCCTGGACGGCGAATCGCGCTGGCG
GCTGGTGTCGCAATTGACCCTCAACCATTTGTCGCTGGTCGAAGGCCCCCAGGCGTTGGACGCATTGCGC
GAGATTCTCCAATTGCACAACCTGCGGGACGAGGCCAGCGCCCATCGCCAGATCGAAGGGGTATCGGGAC
TGGGCTGCGACCGGGTCATCGCCCATGTCGGTGAAGACGCCTGGCGCGGCTGGCGAAATGGGTTGGAGGT
GCGCCTGCAACTGGACCCGCAACACTTTGTCGGCAGCAGCGCCGTGCTGTTCTCCGGGGTGCTGGCGCAA
TTCTTTTCCCTTTATGCCACCGCCAATCGCTTCGTGCGCACCGTGCTGGTCCAGTCCGACAAGGAGGTGA
AGACATGGCAACCCCAAGCCGGCAAACCCCTGGTGCTCTGA
 Primer design