SecReT6
Protein ID: 378950330
SecReT6 ID539
T6SS typei4a
Gene symbolimpF
Locus tagPSF113_2414
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]2815694..2816137 [-]
Productprotein ImpF
NoteTssE
UniProt IDG8QBH6
KEGG IDpfe:PSF113_2414
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.50E-21, Aligned region: 27..122
Protein Sequence: 147 a.a.     [Download]
>gi|378950330|ref|YP_005207818.1| protein ImpF [Pseudomonas fluorescens F113]
MAGFGLRPPLFERLASPADDTGRVFDRQALQDSVHAELSRLFNTRRGPRALTEPPSILDYGIADWTALQQ
QRSDDRRQLTREIRQAITHFEPRLRLGEVEVCPVPGHPQQLCIRLLGELRGDLHAWPVAFVIEHAGDGLE
VRHERLD
 
Nucleotide Sequence: 444 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c2816137-2815694 Pseudomonas fluorescens F113 chromosome, complete genome
ATGGCTGGCTTCGGGCTGCGCCCGCCCCTGTTCGAACGCCTGGCCAGCCCGGCGGACGATACCGGCCGGG
TGTTCGACCGACAGGCGTTGCAGGACTCGGTGCATGCCGAACTGTCGCGCCTGTTCAATACCCGACGCGG
CCCACGGGCGCTGACCGAACCGCCGAGCATCCTCGACTATGGCATCGCCGACTGGACCGCGCTGCAACAG
CAGCGCAGCGATGACCGGCGTCAACTGACCCGGGAAATCCGCCAGGCCATCACTCACTTCGAACCTCGCC
TGCGCCTGGGCGAGGTCGAGGTCTGCCCGGTGCCGGGCCATCCGCAGCAACTGTGCATACGGCTGCTGGG
CGAGCTGCGTGGCGACCTGCACGCATGGCCCGTGGCATTTGTCATCGAGCACGCCGGCGACGGCCTTGAG
GTACGACATGAGCGACTCGATTGA
 Primer design