SecReT6
Protein ID: 378950331
SecReT6 ID539
T6SS typei4a
Gene symbolimpD
Locus tagPSF113_2415
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]2816151..2816648 [-]
Productprotein ImpD
NoteTssD
UniProt IDG8QBH7
KEGG IDpfe:PSF113_2415
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.00E-35, Aligned region: 10..139
Protein Sequence: 165 a.a.     [Download]
>gi|378950331|ref|YP_005207819.1| protein ImpD [Pseudomonas fluorescens F113]
MDAIILDLGGDIKGDSLLEGFTDKIEVMSYSHNVAMQVTNDVSNSERTSGRPHIGEFTLTKFIDSSTPSL
NEYCCAGKPIPQAVITIGRNAAEGSGQIMPFIVYTLTNVVLSNVSVSGGTGGKPVETLSLNFTKIKWELT
AQKDDGTKEGTAGTTWDLAANKMTK
 
Nucleotide Sequence: 498 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c2816648-2816151 Pseudomonas fluorescens F113 chromosome, complete genome
ATGGATGCAATCATTCTCGACCTCGGCGGCGACATCAAGGGCGACAGCCTGCTGGAGGGTTTCACGGACA
AGATCGAGGTCATGTCCTACAGTCACAACGTGGCGATGCAGGTCACCAACGACGTCAGCAACTCGGAGCG
TACCTCCGGCCGGCCGCACATCGGCGAATTCACCCTGACTAAATTCATCGACAGTTCCACCCCTTCGCTC
AATGAGTATTGCTGCGCCGGCAAGCCGATCCCGCAAGCCGTCATCACCATCGGCCGCAACGCCGCCGAGG
GCAGCGGCCAGATCATGCCGTTCATCGTCTACACCCTGACCAACGTCGTGCTGTCCAACGTCAGTGTCAG
CGGCGGCACCGGCGGCAAACCGGTGGAAACCCTGTCGCTGAACTTCACCAAGATCAAATGGGAGCTCACC
GCGCAGAAAGACGACGGCACCAAGGAAGGCACGGCGGGTACGACCTGGGACCTGGCCGCCAACAAAATGA
CCAAGTAA
 Primer design