SecReT6
Protein ID: 378950332
SecReT6 ID539
T6SS typei4a
Gene symbolimpC
Locus tagPSF113_2416
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]2816880..2818361 [-]
Productprotein ImpC
NoteTssC
UniProt IDG8QBH8
KEGG IDpfe:PSF113_2416
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.60E-190, Aligned region: 66..488
Protein Sequence: 493 a.a.     [Download]
>gi|378950332|ref|YP_005207820.1| protein ImpC [Pseudomonas fluorescens F113]
MPASSSAQTSESTTQTLSLLDKIIAEGRMAHDDSQQDYARDMLAEFATQVLDEGMAIDKDTVAMINDRIS
QIDQLISAQLNEVLHHPDLQKLEASWRGLHLLVQNTETSTRLKLRLLNVTQKELQNDLEKAVEFDQSALF
KKIYEEEYGTFGGHPFSLLVGDYTFGRHPQDIGLLEKLSNVAAAAHAPFIAAASPRLFDMTSFTELAIPR
DLSKIFESQELIKWRAFRESEDSRYVSLVLPHFLLRLPYGPDTLPVEGINYVEDVNGTDHSKYLWGNAAW
TLAQRITEAFAKYGWCAAIRGAEGGGAVEGLPAHTFRTSSGDLSLKCPTEVAITDRREKELNDLGFISLC
HKKNSDVAVFFGGQTTNKAKLYNTNEANANARISAMLPYVLAASRFAHYLKVIMRDKVGSFMTRDNVQTY
LNNWIADYVLINDNAPQEIKAQYPLREARVDVTEVAGKPGAYKATVFLRPHFQLEELTASIRLVATLPPP
VAA
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c2818361-2816880 Pseudomonas fluorescens F113 chromosome, complete genome
ATGCCTGCTTCATCCAGCGCTCAAACCAGCGAGAGCACGACCCAGACCCTGTCCCTGCTGGACAAGATCA
TCGCCGAGGGCCGCATGGCCCACGACGACAGCCAGCAAGATTACGCCCGCGACATGCTGGCCGAATTCGC
CACCCAGGTCCTCGACGAAGGCATGGCCATCGACAAGGACACCGTGGCGATGATCAACGACCGCATCAGC
CAGATCGATCAGCTGATCAGCGCCCAGCTCAACGAAGTGCTGCACCATCCCGACCTGCAGAAACTCGAAG
CCTCCTGGCGCGGCCTGCACCTGCTGGTGCAGAACACCGAAACCAGCACCCGGCTCAAATTGCGCCTGCT
CAACGTCACCCAGAAAGAACTGCAGAACGATCTGGAAAAAGCCGTCGAATTCGACCAGAGCGCGCTGTTC
AAGAAGATCTACGAGGAAGAATACGGCACCTTCGGCGGCCACCCGTTCAGCCTGCTGGTGGGTGACTACA
CCTTTGGCCGGCATCCGCAGGACATCGGCCTGCTGGAAAAACTCTCAAACGTCGCCGCCGCCGCGCACGC
GCCTTTCATTGCCGCCGCCAGCCCGCGGTTGTTCGACATGACCAGCTTCACCGAACTGGCGATACCCAGG
GATCTGTCGAAGATTTTCGAGAGCCAGGAGTTGATCAAGTGGCGCGCCTTCCGTGAAAGCGAAGACTCGC
GCTACGTGTCCCTGGTGCTGCCGCACTTCCTGCTGCGCCTGCCGTACGGCCCGGACACGCTGCCGGTGGA
AGGCATCAACTACGTCGAAGACGTCAACGGCACCGACCACAGCAAATACCTGTGGGGCAACGCCGCCTGG
ACCCTGGCGCAACGCATCACCGAAGCCTTTGCCAAATATGGCTGGTGCGCAGCCATTCGCGGGGCCGAGG
GCGGTGGCGCGGTCGAAGGCCTGCCGGCCCATACGTTCCGCACCAGCTCCGGAGACCTGTCGCTCAAATG
CCCGACCGAAGTGGCGATCACCGACCGCCGCGAAAAAGAACTCAACGACCTGGGCTTCATCTCCCTGTGC
CACAAGAAAAACAGCGACGTGGCGGTGTTCTTCGGCGGCCAGACCACCAACAAGGCCAAGCTCTACAACA
CCAACGAGGCCAACGCCAACGCGCGGATCTCGGCAATGTTGCCGTACGTGCTGGCGGCCTCGCGTTTCGC
CCATTACCTGAAGGTGATCATGCGTGACAAGGTCGGCAGTTTCATGACCCGCGACAACGTGCAGACCTAC
CTCAACAACTGGATCGCCGACTACGTGCTGATCAACGATAACGCGCCGCAAGAGATCAAGGCGCAGTACC
CGTTGCGCGAAGCACGGGTGGACGTGACGGAAGTGGCCGGCAAGCCAGGCGCCTACAAGGCCACGGTGTT
CCTGCGGCCGCACTTCCAACTGGAGGAGTTGACCGCCTCGATCCGCCTGGTGGCGACCCTGCCGCCGCCG
GTAGCTGCCTGA
 Primer design