SecReT6
Protein ID: 378950333
SecReT6 ID539
T6SS typei4a
Gene symbolimpB
Locus tagPSF113_2417
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]2818392..2818952 [-]
Productprotein ImpB
NoteTssB
UniProt IDG8QBH9
KEGG IDpfe:PSF113_2417
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.20E-54, Aligned region: 9..161
Protein Sequence: 186 a.a.     [Download]
>gi|378950333|ref|YP_005207821.1| protein ImpB [Pseudomonas fluorescens F113]
MAESTQHKLDRVRPPRVQITYDVEIGNAIEKKELPLVVGILADLSGKPLEPLPKLNERRFTEIDRDNFNE
VLASISPRATLQVNNTLSGDDSKLNIELNFHHIDDFDPVKVVEQVTPLRRLFEARQRLRDLLTKLDGNDD
LDKLLRDVIANTEGLQEIKSARPQDVPPELPAVAANDDPAPAEPQA
 
Nucleotide Sequence: 561 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c2818952-2818392 Pseudomonas fluorescens F113 chromosome, complete genome
ATGGCAGAAAGTACCCAGCACAAGCTCGACAGAGTCCGTCCTCCCCGCGTCCAGATCACCTATGACGTGG
AAATCGGCAACGCCATCGAGAAAAAAGAATTGCCACTGGTGGTCGGCATTCTGGCCGACCTCTCAGGCAA
GCCACTGGAGCCGCTGCCCAAGCTCAACGAGCGGCGCTTCACGGAAATCGATCGGGATAATTTCAACGAG
GTACTCGCGTCCATCTCCCCCCGCGCCACGCTCCAGGTGAACAACACCCTCAGCGGCGACGACAGCAAGC
TCAACATCGAACTCAACTTCCATCACATCGACGACTTCGACCCGGTCAAGGTCGTGGAGCAGGTCACGCC
GCTGCGCCGGTTGTTCGAAGCGCGCCAACGCCTGCGGGACCTGTTGACCAAACTCGATGGCAACGACGAC
CTGGACAAGCTGCTGCGCGACGTGATCGCCAACACCGAAGGCCTTCAGGAAATCAAGTCGGCGCGCCCCC
AGGACGTACCGCCAGAGCTGCCCGCCGTGGCCGCCAACGATGACCCTGCCCCGGCCGAACCACAGGCCTG
A
 Primer design