SecReT6
Protein ID: 378950335
SecReT6 ID539
T6SS typei4a
Gene symbolimpJ
Locus tagPSF113_2419
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]2819691..2821022 [+]
Productprotein ImpJ
NoteTssK
UniProt IDG8QBI1
KEGG IDpfe:PSF113_2419
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.60E-69, Aligned region: 20..411
Protein Sequence: 443 a.a.     [Download]
>gi|378950335|ref|YP_005207823.1| protein ImpJ [Pseudomonas fluorescens F113]
MSLLPDAVCWHEGMQLLPQHFQLQGLRAEALAAYFAGACNPWFWGVSQLEVDPSALSAGQVRLLQLQGTL
PDGLPVNLQAGVGPTLDLDITEAIDKTDDATVTVYLAVSPLWRAGQLVPLKGRLQSVVGEALPDLTSGAF
PESITVWRPNPRLCTQLSKADSICLPLLRIRKEGGGFWRVPYTPPTPILLPESALGRRVAGVCARAREKC
MFLAGRLRQAQAAGNQDDAMEIRRQLTALWARLPEVEGALNTRVATPQALYGLLLGLAGSWSALDPLAGV
PAFAPLDFLELQRGYEPLLDWLETTLELVRAGYRSLAFERDEQVFSIQLPDDEPDQRLVIGLRMPNGASE
QAATDWLRGAIIASARHIPLLTRQRMSGLPHQAMSRNEQVAYSVGEDTRLFVVAASGQWFDAQLPLHIVA
PASAQASSPWQVVLFVAQASESA
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|378947941|ref|NC_016830.1|:2819691-2821022 Pseudomonas fluorescens F113 chromosome, complete genome
ATGAGTCTGTTACCTGACGCGGTGTGCTGGCATGAGGGCATGCAATTGCTGCCCCAGCATTTTCAATTGC
AAGGGCTGCGTGCCGAGGCGCTGGCCGCGTATTTTGCCGGGGCCTGCAACCCTTGGTTCTGGGGCGTAAG
CCAACTGGAAGTCGACCCTTCGGCCCTCAGCGCCGGCCAGGTGCGGCTGCTGCAACTGCAAGGCACCTTG
CCGGACGGCTTGCCGGTCAACCTGCAGGCCGGCGTCGGGCCGACCTTGGATCTGGACATCACCGAGGCGA
TCGACAAGACCGACGATGCCACTGTGACTGTGTACCTGGCCGTCAGCCCACTGTGGCGCGCCGGGCAATT
GGTGCCGCTCAAGGGGCGCCTGCAATCGGTGGTCGGCGAGGCGTTACCAGACCTCACCAGCGGTGCATTT
CCCGAGTCGATCACCGTCTGGCGACCCAACCCGAGGCTGTGCACGCAACTGAGCAAGGCCGATTCGATCT
GCCTGCCGCTGTTGCGCATCCGCAAGGAGGGCGGTGGTTTCTGGCGCGTGCCCTACACCCCACCGACGCC
GATCCTGTTGCCGGAATCGGCCCTCGGTCGACGGGTCGCCGGGGTGTGCGCCCGGGCCCGGGAAAAGTGC
ATGTTTCTCGCCGGTCGCTTGCGTCAGGCCCAGGCGGCTGGCAACCAGGACGATGCCATGGAGATCCGCC
GGCAGTTGACCGCCTTGTGGGCGCGCTTGCCGGAAGTCGAAGGGGCGCTGAACACCCGGGTGGCCACGCC
CCAGGCGCTCTACGGTTTGCTGCTGGGGCTGGCTGGAAGCTGGTCGGCCCTCGATCCGCTGGCGGGCGTC
CCGGCCTTCGCGCCGCTGGACTTCCTCGAATTGCAGCGCGGCTATGAACCGTTGCTCGACTGGCTGGAAA
CCACCCTGGAACTGGTTCGCGCCGGCTATCGCAGCCTGGCCTTCGAGCGCGATGAGCAGGTCTTCTCGAT
CCAGTTGCCTGACGACGAGCCGGACCAACGCCTGGTGATCGGCCTGCGCATGCCCAACGGCGCCAGTGAG
CAGGCCGCAACCGATTGGTTGCGCGGGGCGATCATCGCGTCGGCGCGGCACATCCCGCTGCTGACCCGAC
AACGCATGAGCGGTCTGCCCCATCAGGCCATGAGCCGCAACGAACAGGTGGCCTACAGCGTGGGCGAGGA
CACCCGTTTGTTTGTGGTGGCCGCCAGCGGGCAATGGTTCGACGCGCAATTGCCGCTGCACATCGTGGCG
CCGGCATCGGCCCAGGCCAGCAGCCCGTGGCAAGTGGTGTTGTTCGTGGCGCAAGCCAGTGAAAGTGCCT
GA
 Primer design