SecReT6
Protein ID: 378950336
SecReT6 ID539
T6SS typei4a
Gene symboldotU3
Locus tagPSF113_2420
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]2821041..2821805 [+]
Productprotein DotU3
NoteTssL
UniProt IDG8QBI2
KEGG IDpfe:PSF113_2420
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.30E-39, Aligned region: 16..226
Protein Sequence: 254 a.a.     [Download]
>gi|378950336|ref|YP_005207824.1| protein DotU3 [Pseudomonas fluorescens F113]
MPDGSGGAVRSLHEAPLSSAFRQAWLKWSQEWQDLPKDSDPAVLVNRVVEFSGRSAQRLWRVAFATVGDA
ATEQVKALVYAFVALVDETLLFSPWPGQLAWQQHPLESRMYASRQAGERLPAAIKKLLDEQMPGTRDLAN
VYLQCLILGFQGRLRGEPGQVQHAKWRVALFTFAWQHDPDYVDVSQRLALSSATPPVRMPVQQSLPDGFR
LGLAILAMVLLLTGLGQVFWRDIRSELEPVLQLNESAVVQEQDS
 
Nucleotide Sequence: 765 bp     [Download]
>gi|378947941|ref|NC_016830.1|:2821041-2821805 Pseudomonas fluorescens F113 chromosome, complete genome
ATGCCTGATGGAAGTGGCGGGGCGGTTCGGAGTCTGCATGAGGCGCCGCTGAGCAGCGCTTTTCGCCAGG
CCTGGCTGAAGTGGTCCCAGGAGTGGCAAGACTTGCCCAAGGACAGCGACCCTGCGGTATTGGTCAATCG
GGTGGTGGAGTTCTCCGGGCGCAGCGCCCAGCGTCTGTGGCGGGTGGCCTTCGCCACCGTCGGCGATGCC
GCGACCGAGCAGGTCAAGGCGCTGGTCTACGCCTTCGTGGCGCTGGTGGACGAAACCTTGCTGTTCAGCC
CCTGGCCCGGACAACTGGCGTGGCAGCAGCACCCCCTCGAGTCACGCATGTATGCCAGCCGTCAGGCCGG
CGAGCGCTTGCCGGCGGCGATCAAGAAACTGCTGGACGAGCAAATGCCCGGCACCCGGGACCTGGCGAAT
GTCTACCTGCAATGCCTGATCCTCGGGTTCCAGGGGCGATTGCGTGGCGAGCCGGGCCAGGTCCAGCATG
CCAAGTGGCGCGTGGCGCTGTTCACTTTCGCCTGGCAACACGACCCCGATTACGTCGACGTCAGCCAGCG
CCTGGCGCTGTCTTCGGCGACGCCGCCAGTGCGCATGCCAGTGCAGCAATCGCTGCCGGACGGCTTTCGC
CTGGGGTTGGCGATCCTGGCGATGGTGTTGCTGCTGACTGGCTTGGGGCAGGTGTTCTGGCGTGACATCC
GTTCGGAGCTCGAACCGGTGCTGCAATTGAACGAGTCGGCGGTGGTTCAGGAGCAGGATTCATGA
 Primer design