SecReT6
Protein ID: 378950337
SecReT6 ID539
T6SS typei4a
Gene symbolicmF3
Locus tagPSF113_2421
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]2821802..2825626 [+]
Productprotein IcmF3
NoteTssM
UniProt IDG8QBI3
KEGG IDpfe:PSF113_2421
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 5.70E-32, Aligned region: 114..354
Protein Sequence: 1274 a.a.     [Download]
>gi|378950337|ref|YP_005207825.1| protein IcmF3 [Pseudomonas fluorescens F113]
MSPLSIVALVVLAIVVVLLIAALIWWLRTQGGAAIRSFYGAVRRMEQEQGTRDRYQMPWLMMLGNESDGA
QLCAQWRLQPTDKVAWFGRWFCDAEGSVLVVPQALFLPDDGMNRQRGNWWRLLGLMLRLRSKRPLDAVIW
TVPFSTLDDIEHTTELSLKVRRCFIDLLQRFGLSLPVYVVITGMEELPGVQELVSALPAEARESMLGWSS
PYLPDAAWQSQWSDQALDQVNAALSQSIIEIGALSGQLGTDLYGLPERFEGLRRALQILLEPVFQGNAQG
EAPRCRGVYFTASQAPVVSGDGLTAADSAQRQTVFARQLWSRRLVAERGLAQPVPRLLRLRQRGHRLVGA
VALVVGLVWLGGMVWVWHDSVEQAEGLSRLILSTHKNHLVVDPDEPQLEPTRHNVQNYWNMLEKAPSWRF
VSVVFPTSWFSSVDTQLENGLRLTARHHWILPLRDLLNSDLEQLKSIRNTERRGNVENEDPAQWQSYVKA
KELVELAVRLEQHNQMFSQVVNDPKAPLDELVQLSNTALSLGLNTGTLSRPRFYNRVLFDTQNSDLKGLD
LNAARPVISDNFTGLMQRWLDHYFLADNFVRQAGYLKLHLQRLEAGSGNSLSELEDLMALIDDLQTLVSL
TNSAWGRGKGQDLVPGYSQMLDKVSHSTLLGPDIEQDLESQAAKLQQSFRDQWIVQTGSRDNLLVQQGSG
LLVLQDHVTALDGAVQALFKRDFVALAMQKDPSGNNPDSMGQGDGSDDFSVALNYFASYKSYANEEMPRI
PPDYRDALMQAAEGAAARAMWLSLDESDEALPGMGFNVQTAQAVALQKAFMDVHRGDLAIRFQRLLNRRA
LAQLKSGLDEIDAQPLFSQRADVQRWDGSKNFGLQLYGASDPQDLKLNLAQQFGAMLQIAEQRMPALEWL
IVQQDNLSALEHDQVARFMALNDELLKYKNQNPASSAAQLEQLVSRDFIAMDTTSCAQILQTSSLPGGRG
DLALRTVALQQGALQRCLYLQQNQAAAAWNDLANYFNQYLAGRFPFSQDVRASDADPARVQHLLELIDTR
LPLAQAGLTLSQTPERLAAEDFLNRLKQAGTWLGPLFVRDKSGILGVEMDVRWRTDRDEERGADQVIAWS
LDAGNQQISYPGGGQPNLRWMVGQPVRLTLRWARNGYQRPANDPLQPNLVVRDLEAGWEYQGPWSLLRLM
RSQVASQRQPNVDYTDFPLALQLPVTAQTQARTAQQTLMFVRLSLMSQGSKLPLSIPPLPTRAPRSPFMA
TASSPAIATREEGL
 
Nucleotide Sequence: 3825 bp     [Download]
>gi|378947941|ref|NC_016830.1|:2821802-2825626 Pseudomonas fluorescens F113 chromosome, complete genome
ATGAGCCCCCTGAGCATCGTTGCCCTGGTGGTACTCGCCATCGTCGTGGTGCTGTTGATCGCGGCCCTGA
TCTGGTGGCTGCGTACCCAGGGCGGGGCGGCGATCCGCAGTTTCTATGGGGCGGTGCGCCGCATGGAGCA
GGAGCAGGGCACCCGGGACCGCTATCAGATGCCCTGGCTGATGATGCTCGGCAACGAAAGCGATGGCGCC
CAGTTGTGCGCCCAATGGCGCTTGCAACCGACCGACAAGGTGGCCTGGTTCGGGCGCTGGTTTTGCGATG
CCGAGGGCTCGGTGCTGGTGGTGCCTCAGGCGTTGTTCCTGCCCGATGACGGCATGAACCGGCAACGGGG
CAACTGGTGGCGCCTGCTGGGGCTGATGTTGCGCTTGCGCAGCAAGCGGCCATTGGATGCGGTGATCTGG
ACCGTACCTTTCAGCACCCTTGACGACATCGAGCACACCACCGAGCTGAGCCTCAAGGTCCGGCGGTGCT
TTATCGACCTGTTGCAACGGTTCGGCCTCAGCCTGCCGGTGTACGTGGTGATCACCGGGATGGAAGAGCT
GCCCGGGGTCCAGGAACTGGTCAGCGCGCTGCCCGCCGAGGCGCGTGAATCGATGCTGGGCTGGTCCTCG
CCCTATTTGCCGGATGCGGCCTGGCAGTCGCAGTGGAGTGACCAGGCCCTGGATCAGGTCAACGCGGCGC
TGTCGCAGTCGATCATTGAGATCGGTGCGCTGTCGGGGCAATTGGGCACCGATCTTTATGGGTTGCCGGA
GCGTTTCGAAGGCTTGCGGCGGGCCTTGCAGATCCTGCTGGAGCCGGTGTTCCAGGGCAATGCCCAGGGC
GAAGCACCGCGTTGTCGCGGGGTGTATTTCACTGCCAGCCAGGCGCCGGTTGTCAGCGGTGATGGTTTGA
CCGCCGCCGACAGTGCCCAGCGGCAAACCGTGTTCGCCCGGCAATTGTGGTCACGACGGCTGGTGGCTGA
GCGTGGCCTGGCCCAGCCTGTGCCGCGGCTGCTGCGCCTGCGCCAGCGCGGGCATCGGTTGGTCGGCGCG
GTGGCGTTGGTGGTGGGCCTGGTCTGGTTGGGTGGCATGGTCTGGGTCTGGCACGATTCGGTGGAACAAG
CCGAAGGGCTGTCGCGGTTGATCCTCAGCACCCATAAGAACCATCTCGTGGTCGACCCTGACGAACCGCA
GCTGGAACCGACCCGACACAACGTGCAGAACTACTGGAACATGTTGGAAAAGGCCCCGAGCTGGCGCTTC
GTCTCGGTGGTCTTTCCTACTTCGTGGTTCTCTTCCGTGGACACGCAACTGGAGAATGGGTTGCGCCTGA
CGGCTCGGCACCATTGGATATTGCCCTTGCGGGACCTGCTCAATTCCGACCTGGAACAGCTCAAGTCCAT
CCGCAACACTGAGCGGCGGGGCAATGTGGAGAACGAAGACCCGGCGCAATGGCAGAGTTATGTGAAGGCC
AAGGAACTGGTGGAGCTCGCGGTACGCCTTGAGCAGCACAACCAGATGTTCAGCCAGGTGGTGAACGATC
CCAAGGCACCGCTGGACGAACTGGTGCAACTGAGCAACACCGCCTTGTCCCTGGGTCTCAACACCGGCAC
CTTGAGCCGGCCGCGGTTCTACAACCGGGTGCTGTTCGATACCCAGAACAGCGATTTGAAAGGGCTGGAC
CTGAACGCCGCGCGCCCGGTGATCTCCGATAACTTCACCGGCCTGATGCAGCGCTGGCTGGACCATTACT
TCCTGGCGGACAACTTCGTGCGCCAGGCCGGTTACCTCAAGCTGCACCTGCAACGGCTGGAGGCCGGCAG
TGGCAATTCGTTGAGCGAACTCGAGGACCTGATGGCGCTGATCGACGACTTGCAGACGCTGGTCAGCCTC
ACCAATTCGGCCTGGGGCCGGGGCAAGGGCCAGGACCTGGTACCCGGCTACAGCCAGATGCTGGACAAGG
TCAGCCACAGCACGTTGTTGGGGCCGGATATCGAGCAGGACCTGGAGAGCCAGGCGGCGAAGTTGCAGCA
GAGCTTTCGTGACCAGTGGATCGTCCAGACCGGTTCACGGGACAATCTGCTGGTGCAGCAGGGCAGTGGC
CTGCTGGTTTTGCAAGACCATGTCACGGCGCTGGACGGTGCGGTGCAGGCGCTGTTCAAGCGTGATTTCG
TGGCGTTGGCCATGCAGAAGGATCCGTCGGGCAATAACCCCGACTCGATGGGCCAGGGCGATGGCAGCGA
TGATTTCAGCGTCGCCCTGAACTACTTCGCCAGCTACAAGAGCTATGCCAATGAAGAAATGCCGCGCATT
CCGCCGGATTACCGTGATGCGCTGATGCAGGCCGCCGAAGGTGCTGCGGCCCGGGCCATGTGGTTGAGCC
TGGATGAAAGCGATGAGGCATTGCCCGGTATGGGCTTCAATGTACAAACGGCCCAGGCCGTTGCGCTGCA
AAAAGCCTTCATGGACGTGCACCGTGGCGACCTGGCGATTCGTTTCCAACGTCTGCTCAATCGCCGGGCA
TTGGCGCAACTCAAGAGTGGCCTGGACGAAATCGATGCCCAGCCGCTGTTCAGCCAGCGGGCCGATGTCC
AGCGCTGGGACGGTTCGAAGAACTTCGGCTTGCAACTCTACGGTGCCAGCGATCCACAGGATCTGAAGCT
GAACCTGGCCCAGCAATTCGGCGCGATGCTGCAGATCGCCGAGCAGCGAATGCCCGCGCTGGAATGGTTG
ATCGTCCAGCAGGACAACCTGTCGGCCCTGGAGCATGACCAGGTGGCACGCTTCATGGCCCTCAACGATG
AATTGCTCAAGTACAAGAACCAGAACCCGGCCAGCTCGGCGGCCCAATTGGAACAATTGGTCAGCCGGGA
CTTTATCGCCATGGACACCACTTCCTGCGCGCAGATCTTGCAGACCTCCAGCCTGCCCGGCGGGCGCGGT
GACCTGGCCCTGCGCACCGTCGCGTTGCAGCAGGGCGCCTTGCAACGTTGCTTGTACCTGCAACAAAACC
AGGCCGCGGCCGCCTGGAATGACCTGGCCAACTATTTCAATCAATACCTGGCCGGGCGCTTTCCGTTTTC
CCAGGACGTGCGGGCCAGCGATGCCGACCCGGCGCGGGTCCAGCATTTGCTGGAGCTGATCGACACACGC
CTGCCCTTGGCCCAGGCCGGGCTGACGTTGAGCCAGACGCCAGAGCGGCTGGCGGCCGAGGATTTCCTCA
ACCGTTTGAAACAGGCCGGTACCTGGCTTGGGCCGCTGTTCGTGCGCGACAAGAGTGGCATCCTTGGGGT
GGAAATGGACGTGCGCTGGCGCACCGATCGCGATGAAGAGCGCGGTGCCGACCAGGTGATCGCCTGGAGC
CTGGACGCCGGCAACCAACAGATCAGCTACCCCGGCGGCGGCCAGCCGAACCTGCGCTGGATGGTCGGCC
AGCCTGTACGCTTGACCTTGCGCTGGGCCCGCAACGGCTATCAGCGTCCGGCCAACGACCCGCTGCAACC
GAACCTGGTGGTGCGCGACCTGGAGGCCGGTTGGGAGTACCAGGGGCCTTGGTCATTGCTGCGCCTGATG
CGCTCGCAGGTGGCGAGTCAGCGCCAGCCGAATGTCGACTACACCGATTTCCCCCTGGCCCTGCAACTTC
CGGTGACCGCTCAGACCCAGGCCCGCACGGCGCAGCAAACGTTGATGTTCGTGCGCCTGTCGTTGATGAG
CCAGGGCTCCAAGCTGCCCCTGTCGATCCCGCCACTGCCGACGCGGGCGCCCCGTTCACCTTTCATGGCG
ACCGCTTCGAGCCCCGCCATTGCCACTCGTGAGGAGGGCCTGTGA
 Primer design