SecReT6
Protein ID: 378950338
SecReT6 ID539
T6SS typei4a
Gene symbolimpA
Locus tagPSF113_2422
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]2825623..2826705 [+]
Productprotein ImpA
NoteTssA
UniProt IDG8QBI4
KEGG IDpfe:PSF113_2422
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-19, Aligned region: 63..122
ImpA-rel_N [PF06812], Evalue: 1.10E-19, Aligned region: 216..233
ImpA-rel_N [PF06812], Evalue: 1.10E-19, Aligned region: 240..265
Protein Sequence: 360 a.a.     [Download]
>gi|378950338|ref|YP_005207826.1| protein ImpA [Pseudomonas fluorescens F113]
MSLPISPLPELVSQLLEPISAESPCGPDLRYEPEYDQLRELRREDDTSLPTGVWQSSVKRALWPDLERLA
TTLLLERSKDLMISAWLGEAWLHMAGLEGLPGSLALVAGLCERYPEQLHPQAEEGDQSWRVIPLEWLARR
YSEVLLTRVPLFDGREQAFAAFCLDDWQRLQRQQVLVNDSKNAKASAEAARSDQKKLSELIRNTPLSFWL
HRQGSLMLSLQHLQRLEAWSDAYLGNLAPGYKSLQDVMQALLALVEEFIAMHPQQPTVAPVQTSPATTTS
TPQPQAAPAQVFQEPANREEAYRQLLVIAGYLARTEPHSPVPYLIRRGVEWGNKPLSELLGELISADAES
RRLWTLLGVL
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|378947941|ref|NC_016830.1|:2825623-2826705 Pseudomonas fluorescens F113 chromosome, complete genome
GTGAGCTTGCCGATATCGCCTTTGCCTGAGCTGGTCAGCCAATTGCTCGAGCCGATCAGCGCCGAATCGC
CCTGTGGCCCGGACCTGCGCTACGAACCGGAATATGACCAGTTGCGCGAATTGCGCCGGGAGGACGACAC
CAGCCTGCCCACTGGTGTGTGGCAGTCTTCTGTCAAGCGCGCCCTGTGGCCAGACCTGGAACGGCTCGCG
ACCACGTTGCTGCTTGAGCGCAGCAAGGACCTGATGATCAGCGCCTGGCTGGGGGAGGCCTGGCTGCATA
TGGCCGGGCTGGAAGGGTTGCCGGGCAGTCTGGCGTTGGTGGCAGGGCTGTGTGAGCGCTATCCGGAGCA
GTTGCACCCCCAGGCCGAGGAAGGCGACCAGTCATGGCGGGTGATCCCCCTGGAGTGGTTGGCCCGTCGC
TACAGCGAAGTGCTGCTGACGCGGGTGCCGTTGTTCGACGGCCGGGAACAGGCCTTCGCCGCTTTCTGCC
TGGACGACTGGCAACGCTTGCAGCGCCAGCAAGTGTTGGTCAACGACAGCAAGAACGCCAAGGCCTCGGC
CGAAGCGGCGCGCAGCGATCAAAAGAAGCTCAGCGAACTGATTCGCAACACACCCTTGTCGTTCTGGTTG
CATCGCCAGGGCAGTCTGATGTTGAGTCTGCAACACCTGCAACGGCTCGAAGCTTGGAGCGACGCTTACC
TGGGCAACCTGGCCCCGGGCTACAAATCCCTGCAGGACGTGATGCAGGCCTTGCTGGCACTGGTAGAGGA
GTTCATCGCGATGCACCCACAGCAACCCACCGTCGCGCCGGTGCAAACGTCCCCGGCGACCACGACGTCG
ACGCCCCAGCCGCAGGCAGCACCTGCCCAGGTCTTCCAGGAACCGGCCAATCGTGAAGAGGCCTACCGAC
AGCTACTGGTCATCGCCGGTTACCTGGCCCGTACCGAACCCCACAGCCCGGTGCCCTACCTGATCCGGCG
CGGTGTGGAGTGGGGCAACAAGCCGTTGAGCGAGTTGTTGGGTGAGCTGATCAGTGCCGATGCCGAATCC
CGGCGCTTGTGGACGTTATTGGGCGTTCTCTAA
 Primer design