SecReT6
Protein ID: 378953673
SecReT6 ID540
T6SS typei3
Gene symbolicmF1
Locus tagPSF113_5792
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6672386..6675886 [-]
Productprotein IcmF1
NoteTssM
UniProt IDG8Q710
KEGG IDpfe:PSF113_5792
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.70E-96, Aligned region: 76..122
ImcF-related_N [PF14331], Evalue: 3.70E-96, Aligned region: 187..449
ImcF-related_N [PF14331], Evalue: 3.70E-96, Aligned region: 700..744
IcmF-related [PF06761], Evalue: 1.00E-89, Aligned region: 499..794
DUF1215 [PF06744], Evalue: 1.30E-39, Aligned region: 691..724
DUF1215 [PF06744], Evalue: 1.30E-39, Aligned region: 904..1025
AAA_16 [PF13191], Evalue: 0.0043, Aligned region: 122..250
AAA_16 [PF13191], Evalue: 0.0043, Aligned region: 657..657
Protein Sequence: 1166 a.a.     [Download]
>gi|378953673|ref|YP_005211161.1| protein IcmF1 [Pseudomonas fluorescens F113]
MKAFFSFMTRWVIPLLGLIALSLIIWFVGPLLDWLVPEGRRWALIILVFAVWIAYRVLRIIQARRQAAEV
MRSLAAQTPPDPTSIATAEELETLRQRMDEALALLKKAKLGGDERRNLYELPWYVIIGPPGSGKTTALVN
SGLHFPLAAQLGAGAVRGVGGTRNCDWWFTDQAVLLDTAGRYTTQDSDATIDKAAWLGFLGLLKKQRARR
PIDGAFIAISLSDLLLGSDAERAAHAAAIRLRIQELYTQLGVRFPIYLMLTKLDLVPGFMEYFDTLSKEE
RAQVWGMTFALDDGKSSDSPLAHLQSEFTGLEQRLNDRLVERLQQERDPARRDLIYGFPQQFGALKDCLQ
SFLEGVFKPNAFEERVLLRGVYFTSGTQEGSPIDRLIGSMAQSMNLDRQHLARQTGTGRSYFIEKLFTAV
AFAERGLVGVDPKVERRRKWIARGVLASTVVLVLVVSTLWWVSYRANQAYIAQVDQKVAPLGQTVQNLSP
AQRDVLAVLPLLNAVKHLADDAPSWAEGLGLYQGDMLEAESGSVYRKLLIAVFAPRLLTRIEEQLHSGGN
SDFLYEGLKAYLMLADTEHYDADFIKAWIALDWDRSLPRDLPAEQRQALTAHLQALFERRPPLARLDARL
VEDLRRQLQQLPVAQRVYDRIKRQKLPEGIPDFRINEAAGRDAALVFSRKSGKPLGEPLSGFFTVKGYRQ
GFLLTSLSQTGTLAEEQWVLGHEEADQQNVASLAADVRRLYFQDYLRQWDALLADIDFVPITSVAQAADV
LRVISGPTSPLKKLLVAVAKETDLQQDERLLAAQGAPVEGGVDKLKERLGSLLGQEQATQNAPAQSDDPI
TAHFAELNSIVSKSEGEPAAIDGLLADMNALYVQVSAMVGASGDALLGEAKNQATAAATRVSLNAERQPP
LVQGLVKSVVNSTTNSMMGGVRNQLNAAWTSEVVNIYRQSLAGRYPMSPGSARDATLDDFGQFFGVGGVM
DNYFRKYLQPYVDTSTPTWRWQPGAAQKLGIAPGVLQTFQRAATIRDAFFRSGGTQPMVRFELKPVAMDS
TITQFLLDLDGQQLSYDHGPSRPTAMQWPNPGSIGVVRISIMPPSSSGRSGITLDGPWAWFRLLEQSDLT
AGNSPDRFNLRLRVDGASASYELRANSAFNPFKSRVLSGFSLPERL
 
Nucleotide Sequence: 3501 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c6675886-6672386 Pseudomonas fluorescens F113 chromosome, complete genome
GTGAAGGCGTTTTTCAGTTTTATGACCCGCTGGGTCATCCCATTGCTGGGGCTGATCGCCCTGAGCCTGA
TCATCTGGTTCGTTGGCCCGCTCCTCGATTGGCTGGTGCCCGAAGGCCGCCGCTGGGCCTTGATCATCCT
GGTGTTTGCGGTATGGATCGCCTACCGGGTATTGCGCATTATCCAGGCGCGCCGTCAGGCCGCCGAAGTG
ATGCGCAGCCTGGCCGCGCAAACCCCACCGGACCCGACCAGCATCGCCACCGCCGAGGAGCTCGAAACCC
TGCGCCAGCGCATGGACGAAGCCTTGGCCCTGCTCAAGAAAGCCAAGCTGGGCGGTGACGAGCGCCGCAA
CCTCTACGAGCTACCGTGGTACGTGATCATCGGCCCGCCGGGTTCGGGCAAGACCACCGCGCTGGTCAAT
TCCGGGCTGCATTTCCCACTGGCCGCGCAACTGGGCGCCGGTGCCGTACGCGGTGTCGGCGGTACACGCA
ATTGCGATTGGTGGTTCACCGACCAGGCGGTCCTGCTCGACACCGCCGGCCGCTACACCACCCAGGACAG
CGACGCGACCATCGACAAGGCCGCCTGGCTGGGCTTCCTTGGCCTGTTGAAAAAACAACGGGCCCGGCGC
CCGATTGATGGCGCGTTCATCGCCATCAGCCTGTCCGACCTGCTGCTGGGCAGCGACGCCGAGCGCGCCG
CCCATGCCGCCGCAATCCGGCTGCGGATCCAGGAGCTGTACACCCAACTGGGCGTGCGCTTCCCGATCTA
CCTGATGCTGACCAAGCTCGACCTCGTGCCCGGATTCATGGAGTATTTCGATACCCTGAGCAAGGAAGAG
CGCGCCCAGGTCTGGGGCATGACCTTCGCCCTGGACGATGGCAAGAGCAGCGACAGCCCGCTGGCGCACC
TGCAAAGTGAGTTCACCGGCCTTGAGCAGCGCCTCAACGACCGCTTGGTGGAACGCCTGCAACAAGAGCG
CGACCCGGCGCGGCGCGATCTGATCTACGGTTTCCCGCAGCAGTTCGGCGCCTTGAAAGATTGCCTGCAA
AGCTTCCTCGAAGGCGTGTTCAAACCCAACGCCTTCGAAGAGCGTGTGTTGCTGCGCGGCGTGTATTTCA
CCAGTGGCACCCAGGAAGGCAGCCCGATCGATCGCCTGATCGGCTCCATGGCCCAGAGCATGAACCTGGA
TCGTCAGCACCTGGCGCGCCAGACCGGCACCGGGCGCAGCTACTTCATCGAAAAACTCTTCACCGCCGTG
GCCTTCGCCGAGCGCGGGCTGGTGGGCGTCGATCCGAAAGTCGAGCGGCGGCGCAAGTGGATCGCCCGCG
GCGTTCTGGCCTCCACCGTGGTGTTGGTGTTGGTGGTCAGCACGTTGTGGTGGGTCAGCTACCGCGCCAA
CCAGGCCTACATTGCCCAGGTCGACCAGAAGGTCGCGCCATTGGGGCAAACCGTGCAGAACCTCAGCCCG
GCGCAACGCGACGTCCTCGCCGTGTTGCCGTTGCTCAACGCCGTGAAACATCTTGCTGACGACGCACCGA
GCTGGGCCGAAGGCCTGGGCCTTTACCAGGGCGACATGCTCGAAGCCGAGTCCGGCAGTGTCTATCGCAA
GCTGCTGATCGCAGTGTTCGCGCCACGCTTGCTGACGCGCATCGAAGAGCAACTGCACAGCGGCGGCAAT
TCGGATTTCCTCTACGAAGGCCTGAAGGCCTACCTGATGCTCGCCGACACCGAGCATTACGATGCCGACT
TCATCAAGGCCTGGATCGCCCTGGATTGGGACCGCAGCCTGCCACGGGATTTGCCGGCCGAGCAACGCCA
GGCCCTGACCGCGCATTTGCAGGCGCTGTTCGAGCGGCGTCCGCCACTCGCGCGCCTCGATGCTCGCCTG
GTCGAAGACCTGCGCCGCCAGTTGCAGCAATTGCCGGTGGCCCAGCGGGTCTACGACCGGATCAAGCGCC
AGAAACTGCCTGAAGGCATCCCGGACTTCCGCATCAACGAAGCCGCCGGGCGTGATGCGGCGCTGGTGTT
CAGCCGCAAGAGCGGCAAGCCATTGGGCGAGCCGCTGAGCGGGTTCTTCACCGTCAAGGGCTATCGCCAG
GGCTTCCTGCTCACCAGCCTGAGCCAGACCGGCACCCTGGCCGAAGAGCAATGGGTGCTGGGCCACGAAG
AGGCCGATCAGCAGAACGTCGCCAGCCTGGCCGCCGATGTGCGTCGCCTGTACTTCCAGGATTACCTGCG
CCAATGGGACGCCTTGCTGGCCGACATCGACTTTGTGCCGATCACCAGCGTGGCCCAGGCCGCCGATGTG
CTGCGGGTGATTTCCGGCCCGACCTCACCGTTGAAAAAGCTGTTGGTGGCGGTGGCGAAGGAAACCGACC
TGCAACAGGATGAACGCCTGCTGGCCGCCCAAGGTGCGCCGGTAGAAGGCGGTGTGGACAAACTCAAGGA
ACGCCTGGGCAGCTTGCTCGGCCAGGAGCAGGCGACGCAAAACGCGCCGGCGCAAAGCGATGACCCGATC
ACCGCGCACTTCGCCGAGCTCAACAGCATCGTCAGCAAAAGCGAAGGCGAGCCGGCGGCCATCGACGGCT
TGCTGGCGGACATGAACGCTTTGTACGTGCAGGTCAGCGCCATGGTCGGTGCCAGCGGCGACGCCTTGCT
CGGCGAAGCCAAGAACCAGGCCACGGCCGCCGCTACGCGCGTCAGCCTCAACGCCGAACGCCAGCCGCCG
CTGGTGCAGGGCTTGGTCAAGTCGGTGGTCAACTCCACCACCAACAGCATGATGGGCGGGGTGCGCAACC
AACTGAACGCCGCCTGGACCAGCGAAGTGGTGAACATCTATCGCCAGTCCCTGGCCGGGCGCTATCCGAT
GTCGCCAGGCAGTGCGCGGGACGCGACCCTGGATGACTTCGGCCAGTTCTTCGGCGTCGGCGGGGTGATG
GACAACTACTTCCGCAAGTACCTGCAACCCTACGTCGACACCTCGACCCCAACCTGGCGCTGGCAGCCGG
GCGCGGCGCAGAAGCTCGGTATCGCCCCTGGCGTGCTGCAGACCTTCCAGCGCGCGGCGACCATCCGCGA
TGCGTTCTTCCGTTCCGGCGGCACGCAGCCGATGGTCCGTTTCGAGCTCAAGCCGGTGGCGATGGACTCG
ACCATCACCCAGTTCCTGCTCGACCTCGACGGCCAGCAACTGAGCTACGACCACGGCCCAAGCCGCCCGA
CCGCCATGCAGTGGCCGAACCCGGGCAGCATCGGCGTGGTGCGGATATCGATCATGCCGCCGTCGTCCAG
CGGTCGCTCAGGCATCACCCTGGATGGGCCGTGGGCCTGGTTCCGGCTGCTGGAGCAATCGGACCTGACC
GCCGGCAACTCGCCGGACCGCTTCAACCTGCGGCTGCGGGTCGATGGCGCCAGCGCCTCTTATGAGCTGC
GGGCCAACAGCGCCTTCAACCCATTCAAGAGCCGGGTGCTCAGCGGCTTCAGCCTGCCGGAGCGGCTATG
A
 Primer design