SecReT6
Protein ID: 378953696
SecReT6 ID541
T6SS typei1
Gene symbolstk1
Locus tagPSF113_5815
StrainPseudomonas fluorescens F113
Repliconchromosome [GenBank: NC_016830] [Browse all T6SS(s) in this replicon]
Location [Strand]6707172..6708104 [-]
Producthypothetical protein
NoteStk1
UniProt IDG8Q733
KEGG IDpfe:PSF113_5815
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 2.00E-38, Aligned region: 38..291
Pkinase_Tyr [PF07714], Evalue: 2.10E-25, Aligned region: 40..292
Protein Sequence: 310 a.a.     [Download]
>gi|378953696|ref|YP_005211184.1| hypothetical protein PSF113_5815 [Pseudomonas fluorescens F113]
MSEEGSHSTYSTFANAVPVVTSTQLCVSETPDILAGRYRLERLLGAGGMGVVYRARDLLHEQFADPDPYV
AVKMLSEAFDASPDASTLLYSEFALTRRLHHPNILRPYTFEVDTAQRRAFITMELMRGLTLDKLLCERPL
GLPWPELQAIAVPLFDALAYAHGRGVLHGDVKPSNIMLSEEGLRLFDFGLGLAEEGPSQHLPNLNRERLN
AWTPGYAAPELLEGAPLSAGADVYAVACVVYELASGQHPFQRLPSTQARDARLERALKAPHNLPRRCWAV
LRMALAFDPGQRRISAARLRDALGGVWSWW
 
Nucleotide Sequence: 933 bp     [Download]
>gi|378947941|ref|NC_016830.1|:c6708104-6707172 Pseudomonas fluorescens F113 chromosome, complete genome
GTGAGTGAAGAGGGTAGCCACTCCACGTATTCCACCTTCGCCAACGCTGTGCCTGTTGTGACATCCACCC
AGCTTTGCGTCAGCGAAACACCGGACATACTCGCAGGACGCTATCGCCTTGAACGCTTGCTTGGGGCGGG
CGGCATGGGGGTTGTTTACCGCGCGCGGGATCTGCTGCACGAACAATTCGCTGATCCCGATCCGTACGTT
GCCGTGAAGATGCTCAGCGAGGCATTCGACGCGTCACCCGATGCGAGTACGCTGCTCTACAGCGAGTTCG
CCCTGACGCGGCGATTGCACCACCCGAATATTTTGCGCCCCTACACCTTCGAAGTGGACACAGCCCAACG
ACGGGCCTTCATCACCATGGAGCTGATGCGTGGCCTGACCTTGGACAAACTGCTTTGCGAACGGCCCCTC
GGGCTGCCGTGGCCCGAACTCCAGGCTATCGCCGTGCCGCTGTTCGATGCCCTGGCATACGCCCACGGCC
GTGGCGTACTGCATGGCGATGTGAAGCCAAGCAACATCATGTTGAGCGAAGAAGGCCTGCGCCTGTTCGA
TTTCGGTTTGGGCCTGGCCGAAGAAGGGCCTTCTCAGCACCTGCCAAACCTGAACCGTGAACGCCTTAAC
GCCTGGACCCCTGGTTACGCAGCGCCTGAACTGCTTGAAGGTGCGCCCCTTTCAGCGGGTGCCGATGTCT
ACGCTGTGGCTTGCGTGGTGTATGAACTGGCGAGCGGCCAACATCCGTTCCAGCGGTTACCGTCCACCCA
GGCTCGCGATGCCCGATTGGAGCGCGCGCTCAAGGCGCCGCACAACCTGCCCAGGCGTTGCTGGGCGGTG
CTACGGATGGCGCTGGCGTTTGATCCGGGGCAGCGGCGTATTAGTGCAGCTCGATTGCGTGACGCCTTGG
GTGGTGTGTGGTCTTGGTGGTGA
 Primer design